BLASTX nr result
ID: Mentha29_contig00032310
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00032310 (462 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS66390.1| hypothetical protein M569_08392 [Genlisea aurea] 50 4e-06 >gb|EPS66390.1| hypothetical protein M569_08392 [Genlisea aurea] Length = 419 Score = 50.4 bits (119), Expect(2) = 4e-06 Identities = 26/43 (60%), Positives = 30/43 (69%) Frame = +2 Query: 188 GVSHYLKNEGHGGWVGYLFVSDARLSLSLPLSTCNSNISAEAS 316 G+SHYL EG GWVG LFV DAR LSLP STC+S+ +S Sbjct: 293 GISHYLNTEGPVGWVGNLFVFDAR--LSLPPSTCSSSSQRNSS 333 Score = 25.8 bits (55), Expect(2) = 4e-06 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 22 PLADADKEKTYLLMY 66 PL++ADKE+T +LMY Sbjct: 251 PLSNADKERTDILMY 265