BLASTX nr result
ID: Mentha29_contig00031995
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00031995 (297 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004239808.1| PREDICTED: bifunctional epoxide hydrolase 2-... 59 7e-07 ref|NP_001275417.1| epoxide hydrolase [Solanum tuberosum] gi|407... 59 9e-07 pdb|3CXU|A Chain A, Structure Of A Y149f Mutant Of Epoxide Hydro... 59 9e-07 pdb|2CJP|A Chain A, Structure Of Potato (Solanum Tuberosum) Epox... 59 9e-07 ref|NP_001274907.1| epoxide hydrolase [Solanum tuberosum] gi|407... 58 1e-06 ref|XP_004239805.1| PREDICTED: bifunctional epoxide hydrolase 2-... 58 2e-06 ref|XP_004239806.1| PREDICTED: bifunctional epoxide hydrolase 2-... 57 2e-06 gb|AAA81893.1| epoxide hydrolase, partial [Solanum tuberosum] 57 4e-06 ref|NP_001275381.1| epoxide hydrolase [Solanum tuberosum] gi|407... 57 4e-06 ref|NP_001274962.1| epoxide hydrolase [Solanum tuberosum] gi|407... 55 8e-06 >ref|XP_004239808.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum lycopersicum] Length = 321 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/51 (60%), Positives = 34/51 (66%) Frame = -1 Query: 153 VAPGMSGYGDATGAPLEDPSTSP*STWRVTWIALLDAIASNEEKVFVVGHD 1 VAP + GYGD TGAPL DPS +ALL+AIA NEEKVFVV HD Sbjct: 55 VAPDLRGYGDTTGAPLNDPSKFSIFHLVGDLVALLEAIAPNEEKVFVVAHD 105 >ref|NP_001275417.1| epoxide hydrolase [Solanum tuberosum] gi|407944|gb|AAA81892.1| epoxide hydrolase [Solanum tuberosum] Length = 321 Score = 58.5 bits (140), Expect = 9e-07 Identities = 31/51 (60%), Positives = 34/51 (66%) Frame = -1 Query: 153 VAPGMSGYGDATGAPLEDPSTSP*STWRVTWIALLDAIASNEEKVFVVGHD 1 VAP + GYGD TGAPL DPS +ALL+AIA NEEKVFVV HD Sbjct: 55 VAPDLRGYGDTTGAPLNDPSKFSILHLVGDVVALLEAIAPNEEKVFVVAHD 105 >pdb|3CXU|A Chain A, Structure Of A Y149f Mutant Of Epoxide Hydrolase From Solanum Tuberosum gi|193885363|pdb|3CXU|B Chain B, Structure Of A Y149f Mutant Of Epoxide Hydrolase From Solanum Tuberosum Length = 328 Score = 58.5 bits (140), Expect = 9e-07 Identities = 31/51 (60%), Positives = 34/51 (66%) Frame = -1 Query: 153 VAPGMSGYGDATGAPLEDPSTSP*STWRVTWIALLDAIASNEEKVFVVGHD 1 VAP + GYGD TGAPL DPS +ALL+AIA NEEKVFVV HD Sbjct: 62 VAPDLRGYGDTTGAPLNDPSKFSILHLVGDVVALLEAIAPNEEKVFVVAHD 112 >pdb|2CJP|A Chain A, Structure Of Potato (Solanum Tuberosum) Epoxide Hydrolase I (Steh1) gi|110590994|pdb|2CJP|B Chain B, Structure Of Potato (Solanum Tuberosum) Epoxide Hydrolase I (Steh1) Length = 328 Score = 58.5 bits (140), Expect = 9e-07 Identities = 31/51 (60%), Positives = 34/51 (66%) Frame = -1 Query: 153 VAPGMSGYGDATGAPLEDPSTSP*STWRVTWIALLDAIASNEEKVFVVGHD 1 VAP + GYGD TGAPL DPS +ALL+AIA NEEKVFVV HD Sbjct: 62 VAPDLRGYGDTTGAPLNDPSKFSILHLVGDVVALLEAIAPNEEKVFVVAHD 112 >ref|NP_001274907.1| epoxide hydrolase [Solanum tuberosum] gi|407942|gb|AAA81891.1| epoxide hydrolase [Solanum tuberosum] Length = 321 Score = 58.2 bits (139), Expect = 1e-06 Identities = 31/51 (60%), Positives = 34/51 (66%) Frame = -1 Query: 153 VAPGMSGYGDATGAPLEDPSTSP*STWRVTWIALLDAIASNEEKVFVVGHD 1 VAP + GYGD TGAPL DPS +ALL+AIA NEEKVFVV HD Sbjct: 55 VAPVLRGYGDTTGAPLNDPSKFSILQLVGDVVALLEAIAPNEEKVFVVAHD 105 >ref|XP_004239805.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum lycopersicum] Length = 321 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/51 (58%), Positives = 34/51 (66%) Frame = -1 Query: 153 VAPGMSGYGDATGAPLEDPSTSP*STWRVTWIALLDAIASNEEKVFVVGHD 1 VAP + GYGD TGAPL DPS +ALL+AIA NE+KVFVV HD Sbjct: 55 VAPDLRGYGDTTGAPLNDPSKFTIFHLVGDLVALLEAIAPNEDKVFVVAHD 105 >ref|XP_004239806.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform 1 [Solanum lycopersicum] gi|460388302|ref|XP_004239807.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform 2 [Solanum lycopersicum] Length = 321 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/51 (58%), Positives = 34/51 (66%) Frame = -1 Query: 153 VAPGMSGYGDATGAPLEDPSTSP*STWRVTWIALLDAIASNEEKVFVVGHD 1 VAP + GYGD TGAPL DPS +ALL+AI+ NEEKVFVV HD Sbjct: 55 VAPDLRGYGDTTGAPLNDPSKFSIFHLVGDVVALLEAISPNEEKVFVVAHD 105 >gb|AAA81893.1| epoxide hydrolase, partial [Solanum tuberosum] Length = 305 Score = 56.6 bits (135), Expect = 4e-06 Identities = 29/51 (56%), Positives = 34/51 (66%) Frame = -1 Query: 153 VAPGMSGYGDATGAPLEDPSTSP*STWRVTWIALLDAIASNEEKVFVVGHD 1 VAP + GYGD TGAP+ DPS +ALL+AIA NE+KVFVV HD Sbjct: 39 VAPDLRGYGDTTGAPINDPSKFSIFHLVGDVVALLEAIAPNEDKVFVVAHD 89 >ref|NP_001275381.1| epoxide hydrolase [Solanum tuberosum] gi|407940|gb|AAA81890.1| epoxide hydrolase [Solanum tuberosum] Length = 321 Score = 56.6 bits (135), Expect = 4e-06 Identities = 29/51 (56%), Positives = 34/51 (66%) Frame = -1 Query: 153 VAPGMSGYGDATGAPLEDPSTSP*STWRVTWIALLDAIASNEEKVFVVGHD 1 VAP + GYGD TGAP+ DPS +ALL+AIA NE+KVFVV HD Sbjct: 55 VAPDLRGYGDTTGAPINDPSKFSIFHLVGDVVALLEAIAPNEDKVFVVAHD 105 >ref|NP_001274962.1| epoxide hydrolase [Solanum tuberosum] gi|407938|gb|AAA81889.1| epoxide hydrolase [Solanum tuberosum] Length = 321 Score = 55.5 bits (132), Expect = 8e-06 Identities = 30/51 (58%), Positives = 33/51 (64%) Frame = -1 Query: 153 VAPGMSGYGDATGAPLEDPSTSP*STWRVTWIALLDAIASNEEKVFVVGHD 1 VAP + GYGD TGA L DPS +ALL+AIA NEEKVFVV HD Sbjct: 55 VAPDLRGYGDTTGASLNDPSKFSILHLVGDVVALLEAIAPNEEKVFVVAHD 105