BLASTX nr result
ID: Mentha29_contig00031798
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00031798 (443 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21105.1| hypothetical protein MIMGU_mgv1a021133mg [Mimulus... 56 5e-06 >gb|EYU21105.1| hypothetical protein MIMGU_mgv1a021133mg [Mimulus guttatus] Length = 913 Score = 56.2 bits (134), Expect = 5e-06 Identities = 32/90 (35%), Positives = 47/90 (52%), Gaps = 25/90 (27%) Frame = -1 Query: 443 EGGFSQLIFLQIGKSNLENWISEGRHFPRLKSLVLHMC---------------------- 330 EG F +L FL I +S+L NWI+E HFP LK LV+ C Sbjct: 823 EGEFLELNFLMIEESDLRNWITESSHFPNLKWLVIRRCRYLREIPDGIGEIATLELIEVE 882 Query: 329 ---SHLLQTAKQIQEDRLDSGDDSLQIHVV 249 +L+++AK+IQE++ G+D+LQ+ V Sbjct: 883 MRNKYLVESAKRIQEEQESLGNDALQVRFV 912