BLASTX nr result
ID: Mentha29_contig00031680
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00031680 (379 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528871.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 >ref|XP_002528871.1| conserved hypothetical protein [Ricinus communis] gi|223531670|gb|EEF33495.1| conserved hypothetical protein [Ricinus communis] Length = 94 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -3 Query: 92 REPFQKFSTAQVKQGPKRGFGNSFQPAIDA 3 REPFQKFS A+ K GPKRGFGNSFQPAIDA Sbjct: 59 REPFQKFSKAKGKPGPKRGFGNSFQPAIDA 88