BLASTX nr result
ID: Mentha29_contig00031643
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00031643 (234 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35423.1| hypothetical protein MIMGU_mgv1a007520mg [Mimulus... 57 2e-06 gb|EYU35421.1| hypothetical protein MIMGU_mgv1a007520mg [Mimulus... 57 2e-06 >gb|EYU35423.1| hypothetical protein MIMGU_mgv1a007520mg [Mimulus guttatus] Length = 404 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +2 Query: 134 MPSSNNHGSHIPFASFRRSILTIRSDQVHSEMS 232 MPSS+NH S IPFASFRRSI+TIR+DQ+HSE S Sbjct: 15 MPSSDNHSSAIPFASFRRSIMTIRTDQIHSESS 47 >gb|EYU35421.1| hypothetical protein MIMGU_mgv1a007520mg [Mimulus guttatus] gi|604330384|gb|EYU35422.1| hypothetical protein MIMGU_mgv1a007520mg [Mimulus guttatus] Length = 390 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +2 Query: 134 MPSSNNHGSHIPFASFRRSILTIRSDQVHSEMS 232 MPSS+NH S IPFASFRRSI+TIR+DQ+HSE S Sbjct: 1 MPSSDNHSSAIPFASFRRSIMTIRTDQIHSESS 33