BLASTX nr result
ID: Mentha29_contig00031501
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00031501 (245 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281586.1| PREDICTED: NHP2-like protein 1-like [Vitis v... 59 5e-07 ref|XP_006450946.1| hypothetical protein CICLE_v10009899mg [Citr... 59 7e-07 gb|EYU31670.1| hypothetical protein MIMGU_mgv1a016257mg [Mimulus... 59 9e-07 ref|XP_003549768.1| PREDICTED: NHP2-like protein 1-like [Glycine... 59 9e-07 ref|XP_006376334.1| ribosomal protein L7Ae/L30e/S12e/Gadd45 [Pop... 59 9e-07 gb|EYU26000.1| hypothetical protein MIMGU_mgv1a016274mg [Mimulus... 58 1e-06 ref|XP_006396741.1| hypothetical protein EUTSA_v10029067mg [Eutr... 58 1e-06 ref|XP_006288892.1| hypothetical protein CARUB_v10002254mg [Caps... 58 1e-06 ref|XP_004139318.1| PREDICTED: NHP2-like protein 1-like [Cucumis... 58 1e-06 gb|ADR71290.1| 60S ribosomal protein L7aB [Hevea brasiliensis] 58 1e-06 gb|ADR71289.1| 60S ribosomal protein L7aA [Hevea brasiliensis] 58 1e-06 ref|XP_002873984.1| ribosomal protein L7Ae/L30e/S12e/Gadd45 fami... 58 1e-06 ref|XP_002524478.1| ribosomal protein l7ae, putative [Ricinus co... 58 1e-06 ref|XP_006400583.1| hypothetical protein EUTSA_v10015017mg [Eutr... 58 2e-06 ref|XP_007013421.1| Ribosomal protein L7Ae/L30e/S12e/Gadd45 fami... 57 2e-06 ref|XP_003609312.1| 13 kDa ribonucleoprotein-associated protein ... 57 2e-06 ref|XP_002326012.1| ribosomal protein L7Ae/L30e/S12e/Gadd45 [Pop... 57 2e-06 emb|CBI31588.3| unnamed protein product [Vitis vinifera] 57 2e-06 ref|XP_006284759.1| hypothetical protein CARUB_v10006024mg [Caps... 57 3e-06 ref|XP_005646245.1| L30e-like protein [Coccomyxa subellipsoidea ... 57 3e-06 >ref|XP_002281586.1| PREDICTED: NHP2-like protein 1-like [Vitis vinifera] Length = 128 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -1 Query: 107 MTAEAMNPKAYPLADSALNSTILDLVQQPANYKQL 3 MTAEA+NPKAYPLAD+ L TILDL+QQ ANYKQL Sbjct: 1 MTAEAVNPKAYPLADAQLTITILDLIQQAANYKQL 35 >ref|XP_006450946.1| hypothetical protein CICLE_v10009899mg [Citrus clementina] gi|568843886|ref|XP_006475829.1| PREDICTED: NHP2-like protein 1-like [Citrus sinensis] gi|557554172|gb|ESR64186.1| hypothetical protein CICLE_v10009899mg [Citrus clementina] Length = 128 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -1 Query: 107 MTAEAMNPKAYPLADSALNSTILDLVQQPANYKQL 3 MT EA+NPKAYPLADS L TILDLVQQ ANYKQL Sbjct: 1 MTGEAVNPKAYPLADSNLTITILDLVQQAANYKQL 35 >gb|EYU31670.1| hypothetical protein MIMGU_mgv1a016257mg [Mimulus guttatus] Length = 128 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -1 Query: 107 MTAEAMNPKAYPLADSALNSTILDLVQQPANYKQL 3 MTAE +NPKAYPLAD+ L+ TILDLVQQ ANYKQL Sbjct: 1 MTAETVNPKAYPLADAQLSITILDLVQQAANYKQL 35 >ref|XP_003549768.1| PREDICTED: NHP2-like protein 1-like [Glycine max] Length = 128 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -1 Query: 107 MTAEAMNPKAYPLADSALNSTILDLVQQPANYKQL 3 MT EA+NPKAYPLAD+ L+ TILDLVQQ ANYKQL Sbjct: 1 MTGEAVNPKAYPLADAQLSITILDLVQQAANYKQL 35 >ref|XP_006376334.1| ribosomal protein L7Ae/L30e/S12e/Gadd45 [Populus trichocarpa] gi|118483685|gb|ABK93736.1| unknown [Populus trichocarpa] gi|550325610|gb|ERP54131.1| ribosomal protein L7Ae/L30e/S12e/Gadd45 [Populus trichocarpa] Length = 128 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -1 Query: 107 MTAEAMNPKAYPLADSALNSTILDLVQQPANYKQL 3 MT EA+NPKAYPLAD+ L+ TILDLVQQ ANYKQL Sbjct: 1 MTVEAVNPKAYPLADAQLSITILDLVQQAANYKQL 35 >gb|EYU26000.1| hypothetical protein MIMGU_mgv1a016274mg [Mimulus guttatus] gi|604335326|gb|EYU39268.1| hypothetical protein MIMGU_mgv1a016259mg [Mimulus guttatus] Length = 128 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -1 Query: 107 MTAEAMNPKAYPLADSALNSTILDLVQQPANYKQL 3 MTA+A+NPKAYPLAD+ L TILDLVQQ ANYKQL Sbjct: 1 MTADAVNPKAYPLADAQLTITILDLVQQGANYKQL 35 >ref|XP_006396741.1| hypothetical protein EUTSA_v10029067mg [Eutrema salsugineum] gi|567220064|ref|XP_006413661.1| hypothetical protein EUTSA_v10026563mg [Eutrema salsugineum] gi|557097758|gb|ESQ38194.1| hypothetical protein EUTSA_v10029067mg [Eutrema salsugineum] gi|557114831|gb|ESQ55114.1| hypothetical protein EUTSA_v10026563mg [Eutrema salsugineum] Length = 128 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 107 MTAEAMNPKAYPLADSALNSTILDLVQQPANYKQL 3 MT EA+NPKAYPLADS L+ TILDLVQQ NYKQL Sbjct: 1 MTVEAVNPKAYPLADSQLSITILDLVQQATNYKQL 35 >ref|XP_006288892.1| hypothetical protein CARUB_v10002254mg [Capsella rubella] gi|565461790|ref|XP_006288894.1| hypothetical protein CARUB_v10002256mg [Capsella rubella] gi|482557598|gb|EOA21790.1| hypothetical protein CARUB_v10002254mg [Capsella rubella] gi|482557600|gb|EOA21792.1| hypothetical protein CARUB_v10002256mg [Capsella rubella] Length = 128 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 107 MTAEAMNPKAYPLADSALNSTILDLVQQPANYKQL 3 MT EA+NPKAYPLADS L+ TILDLVQQ NYKQL Sbjct: 1 MTGEAVNPKAYPLADSQLSITILDLVQQATNYKQL 35 >ref|XP_004139318.1| PREDICTED: NHP2-like protein 1-like [Cucumis sativus] gi|449493622|ref|XP_004159380.1| PREDICTED: NHP2-like protein 1-like [Cucumis sativus] Length = 128 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 107 MTAEAMNPKAYPLADSALNSTILDLVQQPANYKQL 3 MT EA+NPKAYPLAD+ L TILDLVQQ ANYKQL Sbjct: 1 MTGEAVNPKAYPLADAQLTITILDLVQQAANYKQL 35 >gb|ADR71290.1| 60S ribosomal protein L7aB [Hevea brasiliensis] Length = 128 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 107 MTAEAMNPKAYPLADSALNSTILDLVQQPANYKQL 3 MT EA+NPKAYPLAD+ L TILDLVQQ ANYKQL Sbjct: 1 MTGEAVNPKAYPLADAQLTITILDLVQQAANYKQL 35 >gb|ADR71289.1| 60S ribosomal protein L7aA [Hevea brasiliensis] Length = 128 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 107 MTAEAMNPKAYPLADSALNSTILDLVQQPANYKQL 3 MT EA+NPKAYPLAD+ L TILDLVQQ ANYKQL Sbjct: 1 MTGEAVNPKAYPLADAQLTITILDLVQQAANYKQL 35 >ref|XP_002873984.1| ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein [Arabidopsis lyrata subsp. lyrata] gi|297319821|gb|EFH50243.1| ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein [Arabidopsis lyrata subsp. lyrata] Length = 128 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 107 MTAEAMNPKAYPLADSALNSTILDLVQQPANYKQL 3 MT EA+NPKAYPLADS L+ TILDLVQQ NYKQL Sbjct: 1 MTGEAVNPKAYPLADSQLSITILDLVQQATNYKQL 35 >ref|XP_002524478.1| ribosomal protein l7ae, putative [Ricinus communis] gi|223536266|gb|EEF37918.1| ribosomal protein l7ae, putative [Ricinus communis] Length = 128 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 107 MTAEAMNPKAYPLADSALNSTILDLVQQPANYKQL 3 MT EA+NPKAYPLAD+ L TILDLVQQ ANYKQL Sbjct: 1 MTGEAVNPKAYPLADAQLTITILDLVQQAANYKQL 35 >ref|XP_006400583.1| hypothetical protein EUTSA_v10015017mg [Eutrema salsugineum] gi|557101673|gb|ESQ42036.1| hypothetical protein EUTSA_v10015017mg [Eutrema salsugineum] Length = 128 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 107 MTAEAMNPKAYPLADSALNSTILDLVQQPANYKQL 3 MT E +NPKAYPLADS L+ TILDL+QQ ANYKQL Sbjct: 1 MTGEVVNPKAYPLADSQLSITILDLIQQAANYKQL 35 >ref|XP_007013421.1| Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein isoform 1 [Theobroma cacao] gi|590578137|ref|XP_007013422.1| Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein isoform 1 [Theobroma cacao] gi|508783784|gb|EOY31040.1| Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein isoform 1 [Theobroma cacao] gi|508783785|gb|EOY31041.1| Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein isoform 1 [Theobroma cacao] Length = 128 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 107 MTAEAMNPKAYPLADSALNSTILDLVQQPANYKQL 3 MT E +NPKAYPLAD+ L +TILDLVQQ ANYKQL Sbjct: 1 MTGEPVNPKAYPLADAQLTTTILDLVQQAANYKQL 35 >ref|XP_003609312.1| 13 kDa ribonucleoprotein-associated protein [Medicago truncatula] gi|502151579|ref|XP_004508510.1| PREDICTED: NHP2-like protein 1-like [Cicer arietinum] gi|217073768|gb|ACJ85244.1| unknown [Medicago truncatula] gi|355510367|gb|AES91509.1| 13 kDa ribonucleoprotein-associated protein [Medicago truncatula] gi|388490702|gb|AFK33417.1| unknown [Medicago truncatula] gi|388516645|gb|AFK46384.1| unknown [Medicago truncatula] Length = 128 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 107 MTAEAMNPKAYPLADSALNSTILDLVQQPANYKQL 3 MT EA+NPKAYPLAD+ L TI+DLVQQ ANYKQL Sbjct: 1 MTGEAVNPKAYPLADAQLTITIMDLVQQAANYKQL 35 >ref|XP_002326012.1| ribosomal protein L7Ae/L30e/S12e/Gadd45 [Populus trichocarpa] gi|118482253|gb|ABK93054.1| unknown [Populus trichocarpa] gi|118483739|gb|ABK93762.1| unknown [Populus trichocarpa] gi|118484687|gb|ABK94214.1| unknown [Populus trichocarpa] gi|222862887|gb|EEF00394.1| ribosomal protein L7Ae/L30e/S12e/Gadd45 [Populus trichocarpa] Length = 128 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 107 MTAEAMNPKAYPLADSALNSTILDLVQQPANYKQL 3 MT EA+NPKAYPLAD+ L TILDLVQQ ANYKQL Sbjct: 1 MTVEAVNPKAYPLADAQLAITILDLVQQAANYKQL 35 >emb|CBI31588.3| unnamed protein product [Vitis vinifera] Length = 142 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -1 Query: 104 TAEAMNPKAYPLADSALNSTILDLVQQPANYKQL 3 TAEA+NPKAYPLAD+ L TILDL+QQ ANYKQL Sbjct: 16 TAEAVNPKAYPLADAQLTITILDLIQQAANYKQL 49 >ref|XP_006284759.1| hypothetical protein CARUB_v10006024mg [Capsella rubella] gi|482553464|gb|EOA17657.1| hypothetical protein CARUB_v10006024mg [Capsella rubella] Length = 128 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 107 MTAEAMNPKAYPLADSALNSTILDLVQQPANYKQL 3 MT EA+NPKAYPLAD+ L+ TILDLVQQ NYKQL Sbjct: 1 MTGEAVNPKAYPLADAQLSITILDLVQQATNYKQL 35 >ref|XP_005646245.1| L30e-like protein [Coccomyxa subellipsoidea C-169] gi|384248216|gb|EIE21701.1| L30e-like protein [Coccomyxa subellipsoidea C-169] Length = 128 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -1 Query: 107 MTAEAMNPKAYPLADSALNSTILDLVQQPANYKQL 3 M+ EA+NPKAYPLAD+ L +TILD+VQQ ANYKQL Sbjct: 1 MSGEAVNPKAYPLADAQLTTTILDIVQQAANYKQL 35