BLASTX nr result
ID: Mentha29_contig00030414
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00030414 (712 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22872.1| hypothetical protein MIMGU_mgv1a026910mg [Mimulus... 58 3e-06 >gb|EYU22872.1| hypothetical protein MIMGU_mgv1a026910mg [Mimulus guttatus] Length = 368 Score = 58.2 bits (139), Expect = 3e-06 Identities = 24/41 (58%), Positives = 33/41 (80%) Frame = +3 Query: 522 LFDFLMNLPSHIIFKIFSRLPTKSIVQCKSVCKQWLDQISD 644 LF ++NLP HII +I +RLP K I+QCKSVCK+WL+ I++ Sbjct: 6 LFFLIINLPPHIIIEILARLPPKKIIQCKSVCKKWLELINE 46