BLASTX nr result
ID: Mentha29_contig00030274
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00030274 (369 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33673.1| hypothetical protein MIMGU_mgv1a010831mg [Mimulus... 59 9e-07 >gb|EYU33673.1| hypothetical protein MIMGU_mgv1a010831mg [Mimulus guttatus] Length = 300 Score = 58.5 bits (140), Expect = 9e-07 Identities = 38/91 (41%), Positives = 46/91 (50%) Frame = -3 Query: 274 PEPNDKEMVAQSGDEKENKESNEAPTETEECNPDEKNLETDFSRXXXXXXXXXXXXXXXX 95 P+ NDKE AQSG+ K EAP + D ++E D SR Sbjct: 79 PQSNDKE-AAQSGENKNAAHQTEAPVADGKTESDS-DVECDLSRDELMKLVVEKEQLLET 136 Query: 94 XXXXXXXXKDKVLRSFAEMENVKDRTRRESE 2 KDKVLR++AEMENVK+RTRRESE Sbjct: 137 KQEELEKMKDKVLRTYAEMENVKERTRRESE 167