BLASTX nr result
ID: Mentha29_contig00029367
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00029367 (285 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44333.1| hypothetical protein MIMGU_mgv1a000009mg [Mimulus... 59 7e-07 gb|EPS71295.1| hypothetical protein M569_03465, partial [Genlise... 57 3e-06 >gb|EYU44333.1| hypothetical protein MIMGU_mgv1a000009mg [Mimulus guttatus] Length = 3157 Score = 58.9 bits (141), Expect = 7e-07 Identities = 34/73 (46%), Positives = 45/73 (61%), Gaps = 2/73 (2%) Frame = -2 Query: 221 VERHESGRIEELLFAVDFHISLEVLNTGQKISIRDSKFSLLSQFRDEELGHNLKVIQNP- 45 VER E G++E+LL VDF +LE++N +KISI SKF +LSQF LG ++ P Sbjct: 1224 VERDEYGKLEQLLLEVDFDFNLELVNAVRKISISISKFCMLSQFMHGNLGQKDNDVRTPF 1283 Query: 44 -SIAPDGSAPRFI 9 +I PD S FI Sbjct: 1284 SAIMPDESFSSFI 1296 >gb|EPS71295.1| hypothetical protein M569_03465, partial [Genlisea aurea] Length = 427 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/58 (46%), Positives = 40/58 (68%) Frame = -2 Query: 221 VERHESGRIEELLFAVDFHISLEVLNTGQKISIRDSKFSLLSQFRDEELGHNLKVIQN 48 VERH SGR++EL A DF+ LE+LN +K+S+ SK S++S+ E+ GH+ VI + Sbjct: 352 VERHNSGRLQELRLAFDFYFILELLNAVRKLSVTASKLSIVSRSMLEDAGHHFSVISS 409