BLASTX nr result
ID: Mentha29_contig00029049
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00029049 (555 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006844624.1| hypothetical protein AMTR_s00016p00227430 [A... 55 9e-06 >ref|XP_006844624.1| hypothetical protein AMTR_s00016p00227430 [Amborella trichopoda] gi|548847095|gb|ERN06299.1| hypothetical protein AMTR_s00016p00227430 [Amborella trichopoda] Length = 298 Score = 55.5 bits (132), Expect = 9e-06 Identities = 29/58 (50%), Positives = 36/58 (62%), Gaps = 8/58 (13%) Frame = +2 Query: 269 PGLELGLSQEGQIGGINLQAFTQFYQQIGGQNGDCSNHD--------EGKENSQGSRQ 418 PGLELGLS +G IG ++ QA +QFYQQIG G +H K++SQGSRQ Sbjct: 241 PGLELGLSPDGHIGVLSTQALSQFYQQIGQSRGGSMHHQHQNQQQGPSSKDDSQGSRQ 298