BLASTX nr result
ID: Mentha29_contig00028449
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00028449 (348 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006344743.1| PREDICTED: uncharacterized protein LOC102600... 58 2e-06 gb|EYU37261.1| hypothetical protein MIMGU_mgv1a001119mg [Mimulus... 57 3e-06 ref|XP_004230289.1| PREDICTED: uncharacterized protein LOC101268... 57 3e-06 >ref|XP_006344743.1| PREDICTED: uncharacterized protein LOC102600562 isoform X1 [Solanum tuberosum] gi|565355747|ref|XP_006344744.1| PREDICTED: uncharacterized protein LOC102600562 isoform X2 [Solanum tuberosum] Length = 907 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/37 (72%), Positives = 33/37 (89%), Gaps = 1/37 (2%) Frame = +3 Query: 240 MEVEKR-GKGGFLQLFDWNTKSKKRLFSSKPDVPESS 347 MEVEKR KGGFLQLFDWN KS+K+LFS+K ++PE+S Sbjct: 1 MEVEKRTSKGGFLQLFDWNIKSRKKLFSNKSELPENS 37 >gb|EYU37261.1| hypothetical protein MIMGU_mgv1a001119mg [Mimulus guttatus] Length = 883 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/37 (72%), Positives = 31/37 (83%), Gaps = 1/37 (2%) Frame = +3 Query: 240 MEVEKRG-KGGFLQLFDWNTKSKKRLFSSKPDVPESS 347 MEVEKR KGGF QLFDWN KS+K+LFS K ++PESS Sbjct: 1 MEVEKRAVKGGFFQLFDWNGKSRKKLFSGKSELPESS 37 >ref|XP_004230289.1| PREDICTED: uncharacterized protein LOC101268805 [Solanum lycopersicum] Length = 902 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/37 (70%), Positives = 33/37 (89%), Gaps = 1/37 (2%) Frame = +3 Query: 240 MEVEKR-GKGGFLQLFDWNTKSKKRLFSSKPDVPESS 347 MEVEKR KGGFLQLFDWN KS+K+LFS+K ++P++S Sbjct: 1 MEVEKRTSKGGFLQLFDWNIKSRKKLFSNKSELPDNS 37