BLASTX nr result
ID: Mentha29_contig00028060
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00028060 (226 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21574.1| hypothetical protein MIMGU_mgv1a017804mg [Mimulus... 60 2e-07 >gb|EYU21574.1| hypothetical protein MIMGU_mgv1a017804mg [Mimulus guttatus] Length = 380 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/47 (61%), Positives = 39/47 (82%), Gaps = 2/47 (4%) Frame = +1 Query: 85 MPSRPL-SDAFTSHPVQH-KFMDLNSFKELPETHAWTSKLDDHPFSG 219 MPSR + SD+F ++P H KF+DL+S KELPE+HAWTS+ +D+PFSG Sbjct: 1 MPSRVVPSDSFRANPTNHHKFLDLSSVKELPESHAWTSQNNDYPFSG 47