BLASTX nr result
ID: Mentha29_contig00027793
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00027793 (217 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46743.1| hypothetical protein MIMGU_mgv1a017988mg [Mimulus... 63 5e-08 >gb|EYU46743.1| hypothetical protein MIMGU_mgv1a017988mg [Mimulus guttatus] Length = 242 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +1 Query: 100 MDEKNQDSIGYAFKGKIMISSITILFSACFIIVAFHVYS 216 MDE+NQDS GY GKIMISSI ILF ACFI+V+FHVY+ Sbjct: 1 MDEENQDSNGYVSNGKIMISSIAILFLACFIVVSFHVYA 39