BLASTX nr result
ID: Mentha29_contig00027538
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00027538 (251 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19327.1| hypothetical protein MIMGU_mgv1a003931mg [Mimulus... 60 2e-07 >gb|EYU19327.1| hypothetical protein MIMGU_mgv1a003931mg [Mimulus guttatus] Length = 554 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/48 (60%), Positives = 32/48 (66%), Gaps = 4/48 (8%) Frame = +3 Query: 3 EPEEMRPGRGEFHEFPSTCICQKPSEYLAAMKDGAR----NFLNVSAD 134 EPEEMRPGRG+F+EFPS CICQKP EY K+ F NVS D Sbjct: 496 EPEEMRPGRGDFNEFPSACICQKPPEYFPLNKNQPHQHFDRFRNVSVD 543