BLASTX nr result
ID: Mentha29_contig00027537
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00027537 (533 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19327.1| hypothetical protein MIMGU_mgv1a003931mg [Mimulus... 62 1e-07 ref|XP_004508925.1| PREDICTED: uncharacterized protein At1g04910... 56 5e-06 >gb|EYU19327.1| hypothetical protein MIMGU_mgv1a003931mg [Mimulus guttatus] Length = 554 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/59 (54%), Positives = 37/59 (62%), Gaps = 4/59 (6%) Frame = -3 Query: 531 EPEEMRPGRGEFHEFPSTCICQKPSEYLAAMKDGAR----NFLNVSADAASDKNIGIKH 367 EPEEMRPGRG+F+EFPS CICQKP EY K+ F NVS D D+ G +H Sbjct: 496 EPEEMRPGRGDFNEFPSACICQKPPEYFPLNKNQPHQHFDRFRNVSVD---DEYFGNEH 551 >ref|XP_004508925.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 [Cicer arietinum] Length = 542 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/61 (47%), Positives = 42/61 (68%), Gaps = 5/61 (8%) Frame = -3 Query: 531 EPEEMRPGRGEFHEFPSTCICQKPSEYLAAM-KDGAR----NFLNVSADAASDKNIGIKH 367 EP+EMRPGRGEFHE+PS+C+C+KP ++ + +DG R F N++ A S+ N G + Sbjct: 474 EPDEMRPGRGEFHEYPSSCVCEKP--FIDELSEDGIRPPKLAFRNLTMGADSEMNEGNEE 531 Query: 366 S 364 S Sbjct: 532 S 532