BLASTX nr result
ID: Mentha29_contig00027535
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00027535 (350 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006348373.1| PREDICTED: interactor of constitutive active... 64 3e-08 ref|XP_004243183.1| PREDICTED: interactor of constitutive active... 64 3e-08 ref|XP_007213896.1| hypothetical protein PRUPE_ppa007058mg [Prun... 60 2e-07 ref|XP_003546766.1| PREDICTED: interactor of constitutive active... 59 7e-07 ref|XP_003543151.1| PREDICTED: interactor of constitutive active... 59 7e-07 ref|XP_007149321.1| hypothetical protein PHAVU_005G060700g [Phas... 58 1e-06 >ref|XP_006348373.1| PREDICTED: interactor of constitutive active ROPs 1-like [Solanum tuberosum] Length = 375 Score = 63.5 bits (153), Expect = 3e-08 Identities = 34/66 (51%), Positives = 40/66 (60%) Frame = +1 Query: 151 MPRSRATELPQRPSPRAXXXXXXXXXXXXXXXXXXXXTTERSPRLSDGRSPRGTQSEPLN 330 MPRSR +E+PQR SPRA T+RSP+L D RSPRG QS+PLN Sbjct: 1 MPRSRGSEMPQRQSPRAPSQLRTSSSESDPLHHRP--VTDRSPKLGDRRSPRGAQSDPLN 58 Query: 331 QRKLGS 348 QRKLG+ Sbjct: 59 QRKLGT 64 >ref|XP_004243183.1| PREDICTED: interactor of constitutive active ROPs 4-like isoform 1 [Solanum lycopersicum] gi|460395222|ref|XP_004243184.1| PREDICTED: interactor of constitutive active ROPs 4-like isoform 2 [Solanum lycopersicum] Length = 370 Score = 63.5 bits (153), Expect = 3e-08 Identities = 34/66 (51%), Positives = 40/66 (60%) Frame = +1 Query: 151 MPRSRATELPQRPSPRAXXXXXXXXXXXXXXXXXXXXTTERSPRLSDGRSPRGTQSEPLN 330 MPRSR +E+PQR SPRA T+RSP+L D RSPRG QS+PLN Sbjct: 1 MPRSRGSEMPQRQSPRAPSQLRTSSSESDPIHHRP--VTDRSPKLGDRRSPRGAQSDPLN 58 Query: 331 QRKLGS 348 QRKLG+ Sbjct: 59 QRKLGT 64 >ref|XP_007213896.1| hypothetical protein PRUPE_ppa007058mg [Prunus persica] gi|462409761|gb|EMJ15095.1| hypothetical protein PRUPE_ppa007058mg [Prunus persica] Length = 384 Score = 60.5 bits (145), Expect = 2e-07 Identities = 32/66 (48%), Positives = 40/66 (60%) Frame = +1 Query: 151 MPRSRATELPQRPSPRAXXXXXXXXXXXXXXXXXXXXTTERSPRLSDGRSPRGTQSEPLN 330 MPRSR +E+ QRPSPR T+RSP+L D RSPRG+QS+PLN Sbjct: 1 MPRSRGSEMVQRPSPRGAHQLRTSSSDSDPLHHRPI--TDRSPKLGDRRSPRGSQSDPLN 58 Query: 331 QRKLGS 348 Q+KLG+ Sbjct: 59 QKKLGT 64 >ref|XP_003546766.1| PREDICTED: interactor of constitutive active ROPs 4 isoformX1 [Glycine max] gi|356556918|ref|XP_003546767.1| PREDICTED: interactor of constitutive active ROPs 4 isoformX2 [Glycine max] gi|571521467|ref|XP_006598164.1| PREDICTED: interactor of constitutive active ROPs 4 isoform X3 [Glycine max] gi|571521471|ref|XP_006598165.1| PREDICTED: interactor of constitutive active ROPs 4 isoform X4 [Glycine max] gi|571521476|ref|XP_006598166.1| PREDICTED: interactor of constitutive active ROPs 4 isoform X5 [Glycine max] Length = 380 Score = 58.9 bits (141), Expect = 7e-07 Identities = 33/66 (50%), Positives = 38/66 (57%) Frame = +1 Query: 151 MPRSRATELPQRPSPRAXXXXXXXXXXXXXXXXXXXXTTERSPRLSDGRSPRGTQSEPLN 330 MPRSR +ELPQR SPR +RSP+L D RSPRGTQSE LN Sbjct: 1 MPRSRGSELPQRQSPRGPHQHRTSSSDSDPLHHRLI--ADRSPKLGDRRSPRGTQSEGLN 58 Query: 331 QRKLGS 348 Q+KLG+ Sbjct: 59 QKKLGT 64 >ref|XP_003543151.1| PREDICTED: interactor of constitutive active ROPs 4-like isoformX1 [Glycine max] gi|356549542|ref|XP_003543152.1| PREDICTED: interactor of constitutive active ROPs 4-like isoformX2 [Glycine max] gi|571500672|ref|XP_006594682.1| PREDICTED: interactor of constitutive active ROPs 4-like isoform X3 [Glycine max] gi|571500676|ref|XP_006594683.1| PREDICTED: interactor of constitutive active ROPs 4-like isoform X4 [Glycine max] gi|571500679|ref|XP_006594684.1| PREDICTED: interactor of constitutive active ROPs 4-like isoform X5 [Glycine max] gi|571500682|ref|XP_006594685.1| PREDICTED: interactor of constitutive active ROPs 4-like isoform X6 [Glycine max] gi|571500686|ref|XP_006594686.1| PREDICTED: interactor of constitutive active ROPs 4-like isoform X7 [Glycine max] Length = 377 Score = 58.9 bits (141), Expect = 7e-07 Identities = 33/66 (50%), Positives = 38/66 (57%) Frame = +1 Query: 151 MPRSRATELPQRPSPRAXXXXXXXXXXXXXXXXXXXXTTERSPRLSDGRSPRGTQSEPLN 330 MPRSR +ELPQR SPR +RSP+L D RSPRGTQSE LN Sbjct: 1 MPRSRGSELPQRQSPRGAHQHRTSSSDSDPLHHRPI--ADRSPKLGDRRSPRGTQSEGLN 58 Query: 331 QRKLGS 348 Q+KLG+ Sbjct: 59 QKKLGT 64 >ref|XP_007149321.1| hypothetical protein PHAVU_005G060700g [Phaseolus vulgaris] gi|561022585|gb|ESW21315.1| hypothetical protein PHAVU_005G060700g [Phaseolus vulgaris] Length = 380 Score = 58.2 bits (139), Expect = 1e-06 Identities = 32/66 (48%), Positives = 38/66 (57%) Frame = +1 Query: 151 MPRSRATELPQRPSPRAXXXXXXXXXXXXXXXXXXXXTTERSPRLSDGRSPRGTQSEPLN 330 MPRSR ++LPQR SPR +RSP+L D RSPRGTQSE LN Sbjct: 1 MPRSRGSDLPQRQSPRGPHQLRTSSSDSDPLHHRPI--ADRSPKLGDRRSPRGTQSEALN 58 Query: 331 QRKLGS 348 Q+KLG+ Sbjct: 59 QKKLGT 64