BLASTX nr result
ID: Mentha29_contig00027392
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00027392 (200 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21353.1| hypothetical protein MIMGU_mgv11b016721mg, partia... 55 8e-06 >gb|EYU21353.1| hypothetical protein MIMGU_mgv11b016721mg, partial [Mimulus guttatus] Length = 522 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/63 (46%), Positives = 41/63 (65%) Frame = +1 Query: 1 KLVLDFQYVNMGMHYASLDLPQLYSLKRLDLRVITQPERNLLSFISLVKVSPQLCEFRIE 180 KLVL+ + + DLPQL SLKRL+L +T+ + + L F+SL+K SP L EF+I+ Sbjct: 314 KLVLNLKTMAPERTNVPCDLPQLDSLKRLELNTVTKTDESFLFFLSLIKASPNLHEFKIK 373 Query: 181 LSY 189 L Y Sbjct: 374 LVY 376