BLASTX nr result
ID: Mentha29_contig00027290
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00027290 (361 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38673.1| hypothetical protein MIMGU_mgv1a015524mg [Mimulus... 65 8e-09 gb|EPS58716.1| hypothetical protein M569_16098 [Genlisea aurea] 65 8e-09 ref|XP_002521730.1| 50S robosomal protein L11, putative [Ricinus... 64 2e-08 ref|XP_004232574.1| PREDICTED: 39S ribosomal protein L11, mitoch... 62 1e-07 ref|XP_007204558.1| hypothetical protein PRUPE_ppa016545mg [Prun... 61 1e-07 ref|XP_002310723.2| ribosomal protein L11 [Populus trichocarpa] ... 61 1e-07 ref|XP_007200434.1| hypothetical protein PRUPE_ppa012772mg [Prun... 61 2e-07 ref|XP_007046480.1| Mitochondrial ribosomal protein L11 [Theobro... 59 5e-07 ref|XP_002277084.1| PREDICTED: 60S ribosomal protein L19, mitoch... 59 5e-07 ref|NP_001064803.1| Os10g0466200 [Oryza sativa Japonica Group] g... 59 7e-07 gb|EAY78848.1| hypothetical protein OsI_33952 [Oryza sativa Indi... 59 7e-07 ref|XP_006425268.1| hypothetical protein CICLE_v10026688mg [Citr... 59 9e-07 ref|XP_004287718.1| PREDICTED: 54S ribosomal protein L19, mitoch... 58 1e-06 dbj|BAB69029.1| mitochondrial ribosomal protein L11 [Triticum ae... 58 2e-06 ref|XP_006661844.1| PREDICTED: 54S ribosomal protein L19, mitoch... 58 2e-06 dbj|BAJ95814.1| predicted protein [Hordeum vulgare subsp. vulgar... 58 2e-06 ref|XP_006412097.1| hypothetical protein EUTSA_v10026461mg [Eutr... 57 2e-06 ref|XP_004982930.1| PREDICTED: 54S ribosomal protein L19, mitoch... 57 2e-06 gb|EMT00341.1| 60S ribosomal protein L19, mitochondrial [Aegilop... 57 2e-06 gb|EMS52961.1| 60S ribosomal protein L19, mitochondrial [Triticu... 57 2e-06 >gb|EYU38673.1| hypothetical protein MIMGU_mgv1a015524mg [Mimulus guttatus] Length = 155 Score = 65.5 bits (158), Expect = 8e-09 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -3 Query: 359 KIKQGDPYCKYLSLEAISKSIIGTAQSMGIKVQKDLD 249 KIKQ DP+C+Y+SLE+ISKSIIGTA SMGIKVQK+LD Sbjct: 119 KIKQSDPFCQYMSLESISKSIIGTANSMGIKVQKELD 155 >gb|EPS58716.1| hypothetical protein M569_16098 [Genlisea aurea] Length = 155 Score = 65.5 bits (158), Expect = 8e-09 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -3 Query: 359 KIKQGDPYCKYLSLEAISKSIIGTAQSMGIKVQKDLD 249 K+KQ DPYC+Y+SLE+ISKSIIGTA+SMGIKVQ DLD Sbjct: 119 KVKQTDPYCQYMSLESISKSIIGTAKSMGIKVQADLD 155 >ref|XP_002521730.1| 50S robosomal protein L11, putative [Ricinus communis] gi|223539121|gb|EEF40717.1| 50S robosomal protein L11, putative [Ricinus communis] Length = 155 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = -3 Query: 359 KIKQGDPYCKYLSLEAISKSIIGTAQSMGIKVQKDLD 249 K+KQ DPYC+Y+SLE+ISKS+IGTA +MGIKV KDLD Sbjct: 119 KVKQSDPYCQYMSLESISKSVIGTANAMGIKVVKDLD 155 >ref|XP_004232574.1| PREDICTED: 39S ribosomal protein L11, mitochondrial-like [Solanum lycopersicum] gi|565347706|ref|XP_006340865.1| PREDICTED: 39S ribosomal protein L11, mitochondrial-like [Solanum tuberosum] Length = 155 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -3 Query: 359 KIKQGDPYCKYLSLEAISKSIIGTAQSMGIKVQKDLD 249 KIKQ DP+C+Y+ LE+I KSIIGTA SMGIKVQK+LD Sbjct: 119 KIKQSDPFCQYMPLESICKSIIGTANSMGIKVQKELD 155 >ref|XP_007204558.1| hypothetical protein PRUPE_ppa016545mg [Prunus persica] gi|462400089|gb|EMJ05757.1| hypothetical protein PRUPE_ppa016545mg [Prunus persica] Length = 154 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 359 KIKQGDPYCKYLSLEAISKSIIGTAQSMGIKVQKDLD 249 K+KQ DPYC+Y+ LE+I KSIIGTA SMGIK+ KDLD Sbjct: 118 KVKQSDPYCQYMPLESICKSIIGTANSMGIKIVKDLD 154 >ref|XP_002310723.2| ribosomal protein L11 [Populus trichocarpa] gi|118482503|gb|ABK93174.1| unknown [Populus trichocarpa] gi|550334468|gb|EEE91173.2| ribosomal protein L11 [Populus trichocarpa] Length = 155 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -3 Query: 359 KIKQGDPYCKYLSLEAISKSIIGTAQSMGIKVQKDLD 249 K+KQ DPYC+Y+SLE+I KSI+GTA +MGIKV KDLD Sbjct: 119 KVKQSDPYCQYMSLESICKSIMGTANTMGIKVVKDLD 155 >ref|XP_007200434.1| hypothetical protein PRUPE_ppa012772mg [Prunus persica] gi|462395834|gb|EMJ01633.1| hypothetical protein PRUPE_ppa012772mg [Prunus persica] Length = 155 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -3 Query: 359 KIKQGDPYCKYLSLEAISKSIIGTAQSMGIKVQKDLD 249 K+KQ DPYC+Y+ LE+I KS+IGTA SMGIK+ KDLD Sbjct: 119 KVKQSDPYCQYMPLESICKSVIGTANSMGIKIVKDLD 155 >ref|XP_007046480.1| Mitochondrial ribosomal protein L11 [Theobroma cacao] gi|508698741|gb|EOX90637.1| Mitochondrial ribosomal protein L11 [Theobroma cacao] Length = 155 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 359 KIKQGDPYCKYLSLEAISKSIIGTAQSMGIKVQKDLD 249 KIKQ DPYC+Y+SLE+I KSIIGTA +MGIKV +LD Sbjct: 119 KIKQSDPYCQYMSLESICKSIIGTANTMGIKVVNELD 155 >ref|XP_002277084.1| PREDICTED: 60S ribosomal protein L19, mitochondrial [Vitis vinifera] gi|147806139|emb|CAN70008.1| hypothetical protein VITISV_038751 [Vitis vinifera] Length = 155 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = -3 Query: 359 KIKQGDPYCKYLSLEAISKSIIGTAQSMGIKVQKDLD 249 K+KQ DPYC+Y+SLE+I KSIIGTA +MGI+V K+LD Sbjct: 119 KVKQSDPYCQYMSLESICKSIIGTANTMGIQVVKELD 155 >ref|NP_001064803.1| Os10g0466200 [Oryza sativa Japonica Group] gi|13489191|gb|AAK27825.1|AC022457_28 putative ribosomal protein L11 [Oryza sativa Japonica Group] gi|31432576|gb|AAP54191.1| ribosomal protein L11 containing protein, expressed [Oryza sativa Japonica Group] gi|113639412|dbj|BAF26717.1| Os10g0466200 [Oryza sativa Japonica Group] gi|125575082|gb|EAZ16366.1| hypothetical protein OsJ_31828 [Oryza sativa Japonica Group] gi|215686598|dbj|BAG88851.1| unnamed protein product [Oryza sativa Japonica Group] Length = 155 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -3 Query: 359 KIKQGDPYCKYLSLEAISKSIIGTAQSMGIKVQKDL 252 K+KQ DPYCK++SLEA+ KSIIGTA SMGI++ KDL Sbjct: 120 KLKQSDPYCKHMSLEALCKSIIGTANSMGIEIVKDL 155 >gb|EAY78848.1| hypothetical protein OsI_33952 [Oryza sativa Indica Group] Length = 155 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -3 Query: 359 KIKQGDPYCKYLSLEAISKSIIGTAQSMGIKVQKDL 252 K+KQ DPYCK++SLEA+ KSIIGTA SMGI++ KDL Sbjct: 120 KLKQSDPYCKHMSLEALCKSIIGTANSMGIEIVKDL 155 >ref|XP_006425268.1| hypothetical protein CICLE_v10026688mg [Citrus clementina] gi|568825459|ref|XP_006467095.1| PREDICTED: 54S ribosomal protein L19, mitochondrial-like [Citrus sinensis] gi|557527258|gb|ESR38508.1| hypothetical protein CICLE_v10026688mg [Citrus clementina] Length = 155 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -3 Query: 359 KIKQGDPYCKYLSLEAISKSIIGTAQSMGIKVQKDLD 249 K+KQ DPYC+Y+ LE+I KSIIGTA +MGIKV K+LD Sbjct: 119 KVKQSDPYCQYMPLESICKSIIGTAATMGIKVVKELD 155 >ref|XP_004287718.1| PREDICTED: 54S ribosomal protein L19, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 155 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -3 Query: 359 KIKQGDPYCKYLSLEAISKSIIGTAQSMGIKVQKDLD 249 K+KQ DPYC+Y+ LE+I KS+IGTA SMGI+V KDL+ Sbjct: 119 KVKQSDPYCQYMPLESICKSVIGTANSMGIQVVKDLE 155 >dbj|BAB69029.1| mitochondrial ribosomal protein L11 [Triticum aestivum] gi|475336510|gb|EMT00345.1| 60S ribosomal protein L19, mitochondrial [Aegilops tauschii] Length = 154 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/36 (69%), Positives = 33/36 (91%) Frame = -3 Query: 359 KIKQGDPYCKYLSLEAISKSIIGTAQSMGIKVQKDL 252 K+KQ DP+CK++SLEA+ KSIIGTA+SMGI++ KDL Sbjct: 119 KLKQSDPFCKHMSLEALCKSIIGTAKSMGIEIVKDL 154 >ref|XP_006661844.1| PREDICTED: 54S ribosomal protein L19, mitochondrial-like [Oryza brachyantha] Length = 155 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = -3 Query: 359 KIKQGDPYCKYLSLEAISKSIIGTAQSMGIKVQKDL 252 K+KQ DPYCK++S+EA+ KSIIGTA SMGI++ KDL Sbjct: 120 KLKQSDPYCKHMSVEALCKSIIGTANSMGIEIVKDL 155 >dbj|BAJ95814.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326510169|dbj|BAJ87301.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 154 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/36 (69%), Positives = 33/36 (91%) Frame = -3 Query: 359 KIKQGDPYCKYLSLEAISKSIIGTAQSMGIKVQKDL 252 K+KQ DP+CK++SLEA+ KSIIGTA+SMGI++ KDL Sbjct: 119 KLKQSDPFCKHMSLEALCKSIIGTAKSMGIEIVKDL 154 >ref|XP_006412097.1| hypothetical protein EUTSA_v10026461mg [Eutrema salsugineum] gi|557113267|gb|ESQ53550.1| hypothetical protein EUTSA_v10026461mg [Eutrema salsugineum] Length = 155 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -3 Query: 359 KIKQGDPYCKYLSLEAISKSIIGTAQSMGIKVQKDLD 249 K+KQ DP+C+Y+ LE+I KSIIGTA SMGIK+ KDL+ Sbjct: 119 KVKQTDPFCQYMPLESICKSIIGTANSMGIKIVKDLE 155 >ref|XP_004982930.1| PREDICTED: 54S ribosomal protein L19, mitochondrial-like isoform X1 [Setaria italica] gi|514816377|ref|XP_004982931.1| PREDICTED: 54S ribosomal protein L19, mitochondrial-like isoform X2 [Setaria italica] gi|514816379|ref|XP_004982932.1| PREDICTED: 54S ribosomal protein L19, mitochondrial-like isoform X3 [Setaria italica] Length = 156 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = -3 Query: 359 KIKQGDPYCKYLSLEAISKSIIGTAQSMGIKVQKDL 252 K+KQ DP+CK++SLEA+ KSIIGTA SMGI++ KDL Sbjct: 121 KLKQADPFCKHMSLEALCKSIIGTANSMGIEIVKDL 156 >gb|EMT00341.1| 60S ribosomal protein L19, mitochondrial [Aegilops tauschii] Length = 154 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = -3 Query: 359 KIKQGDPYCKYLSLEAISKSIIGTAQSMGIKVQKDL 252 K+KQ DP+CK++SLEA+ KSIIGTA SMGI++ KDL Sbjct: 119 KLKQADPFCKHMSLEALCKSIIGTANSMGIEIVKDL 154 >gb|EMS52961.1| 60S ribosomal protein L19, mitochondrial [Triticum urartu] Length = 154 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = -3 Query: 359 KIKQGDPYCKYLSLEAISKSIIGTAQSMGIKVQKDL 252 K+KQ DP+CK++SLEA+ KSIIGTA SMGI++ KDL Sbjct: 119 KLKQADPFCKHMSLEALCKSIIGTANSMGIEIVKDL 154