BLASTX nr result
ID: Mentha29_contig00027146
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00027146 (504 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19891.1| hypothetical protein MIMGU_mgv1a026881mg [Mimulus... 66 4e-09 >gb|EYU19891.1| hypothetical protein MIMGU_mgv1a026881mg [Mimulus guttatus] Length = 1188 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/61 (47%), Positives = 45/61 (73%), Gaps = 2/61 (3%) Frame = -2 Query: 218 VVGPCFKGDNMDISSIPPGFESLVPFPLRKMEHDQVSNYSSAGKPFRAENIQLESR--CN 45 +VGPC K D+M+I SIPPGFES VPF +++ E +QV +YSS+ + ++ ++LE+ CN Sbjct: 5 LVGPCMKEDSMEIPSIPPGFESFVPFTVKRAEDNQVGSYSSSARVVESQTVKLETEFDCN 64 Query: 44 D 42 + Sbjct: 65 N 65