BLASTX nr result
ID: Mentha29_contig00027037
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00027037 (247 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74345.1| hypothetical protein M569_00407, partial [Genlise... 170 2e-40 ref|XP_003588355.1| Mitochondrial protein, putative [Medicago tr... 80 4e-13 >gb|EPS74345.1| hypothetical protein M569_00407, partial [Genlisea aurea] Length = 84 Score = 170 bits (430), Expect = 2e-40 Identities = 81/82 (98%), Positives = 81/82 (98%) Frame = -2 Query: 246 NVVRQFGSYLPLVLKGELRGANPSTRGLGWANLWSTGCYANSSAGQLSWYGRTAAQREIL 67 NVVRQFGSYLPLVLKGELRGANPSTRGLGWANLWSTGCYANSSAG LSWYGRTAAQREIL Sbjct: 1 NVVRQFGSYLPLVLKGELRGANPSTRGLGWANLWSTGCYANSSAGLLSWYGRTAAQREIL 60 Query: 66 LYTSSRTRFLNRTSIGERCKHR 1 LYTSSRTRFLNRTSIGERCKHR Sbjct: 61 LYTSSRTRFLNRTSIGERCKHR 82 >ref|XP_003588355.1| Mitochondrial protein, putative [Medicago truncatula] gi|355477403|gb|AES58606.1| Mitochondrial protein, putative [Medicago truncatula] Length = 1106 Score = 79.7 bits (195), Expect = 4e-13 Identities = 46/81 (56%), Positives = 46/81 (56%) Frame = +3 Query: 3 GAYTSRLSKFCSKTSSENLYREGFPAAQQFFHTNLAARRCYWHNNR*TIGWPNPVLSY*G 182 GAYTSRLSKFCSKTS ENLYREGFP G Sbjct: 370 GAYTSRLSKFCSKTSFENLYREGFP----------------------------------G 395 Query: 183 WLLAVLPLTPTVDRNRTVSRR 245 WLLAVLPLTPTVDRNRTVSRR Sbjct: 396 WLLAVLPLTPTVDRNRTVSRR 416