BLASTX nr result
ID: Mentha29_contig00026607
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00026607 (485 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007047177.1| Uncharacterized protein TCM_000563 [Theobrom... 64 2e-08 ref|XP_003611791.1| hypothetical protein MTR_5g017880 [Medicago ... 59 5e-07 ref|XP_007156826.1| hypothetical protein PHAVU_002G021000g [Phas... 57 2e-06 >ref|XP_007047177.1| Uncharacterized protein TCM_000563 [Theobroma cacao] gi|508699438|gb|EOX91334.1| Uncharacterized protein TCM_000563 [Theobroma cacao] Length = 51 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/51 (56%), Positives = 37/51 (72%), Gaps = 5/51 (9%) Frame = +2 Query: 140 MDPPEAQSIERNPPM----DDEQDKAIDQCCNWCYDCTDTCFDYLFC-DLC 277 M+ P QSIE + +DEQDKA+D+CC+ CYDCT+TCFDYL C +LC Sbjct: 1 MEAPATQSIETSTNNFQVEEDEQDKAVDECCSCCYDCTETCFDYLCCFNLC 51 >ref|XP_003611791.1| hypothetical protein MTR_5g017880 [Medicago truncatula] gi|355513126|gb|AES94749.1| hypothetical protein MTR_5g017880 [Medicago truncatula] Length = 79 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/44 (59%), Positives = 31/44 (70%), Gaps = 1/44 (2%) Frame = +2 Query: 140 MDPPEAQSIE-RNPPMDDEQDKAIDQCCNWCYDCTDTCFDYLFC 268 MDPP+ QSI+ NP DD QDK I+ CC+ CYDCT FD+L C Sbjct: 1 MDPPQTQSIDISNPAGDDLQDKIINDCCSCCYDCTQGFFDFLCC 44 >ref|XP_007156826.1| hypothetical protein PHAVU_002G021000g [Phaseolus vulgaris] gi|561030241|gb|ESW28820.1| hypothetical protein PHAVU_002G021000g [Phaseolus vulgaris] Length = 44 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/46 (52%), Positives = 32/46 (69%) Frame = +2 Query: 140 MDPPEAQSIERNPPMDDEQDKAIDQCCNWCYDCTDTCFDYLFCDLC 277 M+PP +QSI+ DD QDK I++CC+ CYDCT FD+L C+ C Sbjct: 1 MEPPPSQSIQIAG--DDSQDKVINECCSCCYDCTQGLFDFLCCNFC 44