BLASTX nr result
ID: Mentha29_contig00026473
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00026473 (775 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN71467.1| hypothetical protein VITISV_038988 [Vitis vinifera] 97 5e-18 ref|XP_003588268.1| NADH-ubiquinone oxidoreductase chain [Medica... 75 5e-14 ref|XP_002451896.1| hypothetical protein SORBIDRAFT_04g009491 [S... 61 2e-07 gb|EYU29384.1| hypothetical protein MIMGU_mgv11b014877mg, partia... 60 7e-07 >emb|CAN71467.1| hypothetical protein VITISV_038988 [Vitis vinifera] Length = 280 Score = 97.4 bits (241), Expect = 5e-18 Identities = 52/76 (68%), Positives = 53/76 (69%), Gaps = 9/76 (11%) Frame = -1 Query: 598 LDSRIFCFSGGGEQWCLRCSRCPP-------ERTAH*LAGL--GGPIWRHTENHAFRTER 446 LDSRIFCFSGGGEQ LRC RCPP R LA GGPI RHTENHAFRTER Sbjct: 52 LDSRIFCFSGGGEQCSLRCGRCPPVGPGLLPARKNRSLASRTSGGPIRRHTENHAFRTER 111 Query: 445 NARLPNKNKKGLVGKK 398 NARLP K K GLVGK+ Sbjct: 112 NARLPKKKKNGLVGKR 127 >ref|XP_003588268.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] gi|355477316|gb|AES58519.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] Length = 556 Score = 74.7 bits (182), Expect(2) = 5e-14 Identities = 42/83 (50%), Positives = 45/83 (54%) Frame = +3 Query: 525 SGGHLLQRKHHCSPPPEKQKIRESRLKIHA*IVV*CQGRRRKLGTEPYEAKVSRTVL*EG 704 +GGHL QRK HCSPPP+KQKIRES Sbjct: 294 TGGHLPQRKLHCSPPPDKQKIRES------------------------------------ 317 Query: 705 SGYLLELRPTTTGQFRFGATPYS 773 SGYLLELRPTTTG+FRFGATPYS Sbjct: 318 SGYLLELRPTTTGKFRFGATPYS 340 Score = 29.6 bits (65), Expect(2) = 5e-14 Identities = 17/27 (62%), Positives = 19/27 (70%), Gaps = 3/27 (11%) Frame = +1 Query: 460 RHGFQYVSR*G---PLVRLASERFFRA 531 RH F + + G PLVRLASERFFRA Sbjct: 261 RHFFGPLKKKGNGPPLVRLASERFFRA 287 >ref|XP_002451896.1| hypothetical protein SORBIDRAFT_04g009491 [Sorghum bicolor] gi|241931727|gb|EES04872.1| hypothetical protein SORBIDRAFT_04g009491 [Sorghum bicolor] Length = 289 Score = 60.8 bits (146), Expect(2) = 2e-07 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -1 Query: 616 YACIFSLDSRIFCFSGGGEQWCLRCSRCPP 527 YAC+F LDSRIFCFSGGGEQ LRC RCPP Sbjct: 239 YACLFRLDSRIFCFSGGGEQCSLRCGRCPP 268 Score = 21.2 bits (43), Expect(2) = 2e-07 Identities = 6/10 (60%), Positives = 9/10 (90%) Frame = -3 Query: 635 LALDHYLCMY 606 L+LDHY C++ Sbjct: 234 LSLDHYACLF 243 >gb|EYU29384.1| hypothetical protein MIMGU_mgv11b014877mg, partial [Mimulus guttatus] Length = 197 Score = 60.5 bits (145), Expect = 7e-07 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -3 Query: 281 LDLRPLRYDYCDVSGSNWFDLSQSFWTELVRSTCTE 174 LD +P + DVSGSNWFDLSQSFWTELVRSTCTE Sbjct: 75 LDNKPKGFLIDDVSGSNWFDLSQSFWTELVRSTCTE 110