BLASTX nr result
ID: Mentha29_contig00026377
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00026377 (358 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007147627.1| hypothetical protein PHAVU_006G140600g [Phas... 57 3e-06 ref|XP_007026335.1| Uncharacterized protein TCM_030414 [Theobrom... 56 5e-06 >ref|XP_007147627.1| hypothetical protein PHAVU_006G140600g [Phaseolus vulgaris] gi|561020850|gb|ESW19621.1| hypothetical protein PHAVU_006G140600g [Phaseolus vulgaris] Length = 235 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = -3 Query: 131 NIQFSTLVFSLSAHSLDRKYMFLICNGIVAFLVKTFTFSSSSS 3 N FST +FS+ H+L+RKYMFLICNGI+AF+ KT +SS S Sbjct: 52 NAYFSTCLFSMFTHTLERKYMFLICNGILAFVAKTALVNSSDS 94 >ref|XP_007026335.1| Uncharacterized protein TCM_030414 [Theobroma cacao] gi|508781701|gb|EOY28957.1| Uncharacterized protein TCM_030414 [Theobroma cacao] Length = 245 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = -3 Query: 131 NIQFSTLVFSLSAHSLDRKYMFLICNGIVAFLVKTFTFSSSS 6 ++ FST +FS H+L+RKYMFLICNGI+AFL K+ SSSS Sbjct: 54 SVYFSTFLFSFFTHTLERKYMFLICNGILAFLAKSSVPSSSS 95