BLASTX nr result
ID: Mentha29_contig00025458
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00025458 (247 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007224225.1| hypothetical protein PRUPE_ppa017894mg [Prun... 97 2e-18 ref|XP_007035438.1| Uncharacterized protein TCM_021112 [Theobrom... 96 4e-18 ref|XP_004495005.1| PREDICTED: uncharacterized protein LOC101499... 96 5e-18 ref|XP_006402373.1| hypothetical protein EUTSA_v10006352mg [Eutr... 95 9e-18 ref|XP_006290289.1| hypothetical protein CARUB_v10018431mg [Caps... 94 1e-17 gb|EYU43876.1| hypothetical protein MIMGU_mgv1a017789mg [Mimulus... 94 2e-17 ref|XP_007144463.1| hypothetical protein PHAVU_007G158300g [Phas... 92 7e-17 gb|AFK40452.1| unknown [Lotus japonicus] 92 1e-16 ref|XP_006594081.1| PREDICTED: uncharacterized protein LOC100810... 92 1e-16 ref|XP_007135195.1| hypothetical protein PHAVU_010G109000g [Phas... 91 1e-16 ref|NP_191804.1| uncharacterized protein [Arabidopsis thaliana] ... 91 2e-16 ref|XP_002876675.1| predicted protein [Arabidopsis lyrata subsp.... 91 2e-16 ref|XP_002516849.1| conserved hypothetical protein [Ricinus comm... 91 2e-16 ref|XP_003595500.1| hypothetical protein MTR_2g048470 [Medicago ... 90 4e-16 ref|XP_003590509.1| hypothetical protein MTR_1g068580 [Medicago ... 89 6e-16 ref|NP_001176304.1| Os11g0107450 [Oryza sativa Japonica Group] g... 86 4e-15 gb|ABE91880.2| hypothetical protein MtrDRAFT_AC140551g61v2 [Medi... 86 7e-15 ref|XP_003631961.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase 2... 84 2e-14 dbj|BAK06248.1| predicted protein [Hordeum vulgare subsp. vulgare] 83 3e-14 ref|XP_003579048.1| PREDICTED: uncharacterized protein LOC100836... 82 6e-14 >ref|XP_007224225.1| hypothetical protein PRUPE_ppa017894mg [Prunus persica] gi|462421161|gb|EMJ25424.1| hypothetical protein PRUPE_ppa017894mg [Prunus persica] Length = 71 Score = 97.4 bits (241), Expect = 2e-18 Identities = 44/51 (86%), Positives = 49/51 (96%) Frame = +2 Query: 95 MKFWDWYLKIAVGSALVGGSMEFFMIKTGFYDKVTVLEAEKRAWDNSPEAQ 247 MKF DWY+KIA+GSAL+G SMEFFMIKTGFYDKVTVLE+EKRAW+NSPEAQ Sbjct: 1 MKFLDWYVKIALGSALIGASMEFFMIKTGFYDKVTVLESEKRAWENSPEAQ 51 >ref|XP_007035438.1| Uncharacterized protein TCM_021112 [Theobroma cacao] gi|508714467|gb|EOY06364.1| Uncharacterized protein TCM_021112 [Theobroma cacao] Length = 73 Score = 96.3 bits (238), Expect = 4e-18 Identities = 44/51 (86%), Positives = 49/51 (96%) Frame = +2 Query: 95 MKFWDWYLKIAVGSALVGGSMEFFMIKTGFYDKVTVLEAEKRAWDNSPEAQ 247 +KF DWYLKIAVGSAL+GGSME FMIKTGFYDKVTVLE+EKRAW++SPEAQ Sbjct: 3 IKFLDWYLKIAVGSALIGGSMEMFMIKTGFYDKVTVLESEKRAWESSPEAQ 53 >ref|XP_004495005.1| PREDICTED: uncharacterized protein LOC101499473 [Cicer arietinum] Length = 71 Score = 95.9 bits (237), Expect = 5e-18 Identities = 44/51 (86%), Positives = 47/51 (92%) Frame = +2 Query: 95 MKFWDWYLKIAVGSALVGGSMEFFMIKTGFYDKVTVLEAEKRAWDNSPEAQ 247 MKF DWYLKI V SALVG SMEFFM+KTGFYDKVTVLE+EKRAW+NSPEAQ Sbjct: 1 MKFLDWYLKIGVASALVGASMEFFMVKTGFYDKVTVLESEKRAWENSPEAQ 51 >ref|XP_006402373.1| hypothetical protein EUTSA_v10006352mg [Eutrema salsugineum] gi|557103472|gb|ESQ43826.1| hypothetical protein EUTSA_v10006352mg [Eutrema salsugineum] Length = 74 Score = 95.1 bits (235), Expect = 9e-18 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = +2 Query: 98 KFWDWYLKIAVGSALVGGSMEFFMIKTGFYDKVTVLEAEKRAWDNSPEAQ 247 KF DWYLKIA+GSA++GG MEFFMIKTGFYDKVTVLEAEKRA++NSPEAQ Sbjct: 5 KFLDWYLKIAIGSAIIGGGMEFFMIKTGFYDKVTVLEAEKRAYENSPEAQ 54 >ref|XP_006290289.1| hypothetical protein CARUB_v10018431mg [Capsella rubella] gi|482558996|gb|EOA23187.1| hypothetical protein CARUB_v10018431mg [Capsella rubella] Length = 74 Score = 94.4 bits (233), Expect = 1e-17 Identities = 41/50 (82%), Positives = 47/50 (94%) Frame = +2 Query: 98 KFWDWYLKIAVGSALVGGSMEFFMIKTGFYDKVTVLEAEKRAWDNSPEAQ 247 +F DWYLKIA+GSA++GG ME FMIKTGFYDKVTV+EAEKRAW+NSPEAQ Sbjct: 5 RFLDWYLKIAIGSAIIGGGMELFMIKTGFYDKVTVIEAEKRAWENSPEAQ 54 >gb|EYU43876.1| hypothetical protein MIMGU_mgv1a017789mg [Mimulus guttatus] Length = 72 Score = 94.0 bits (232), Expect = 2e-17 Identities = 43/51 (84%), Positives = 48/51 (94%) Frame = +2 Query: 95 MKFWDWYLKIAVGSALVGGSMEFFMIKTGFYDKVTVLEAEKRAWDNSPEAQ 247 MKF DWYLKIAV SA++GGSMEFFMIKTGFYDKVT LE+EKRAW+N+PEAQ Sbjct: 1 MKFVDWYLKIAVVSAMIGGSMEFFMIKTGFYDKVTELESEKRAWENTPEAQ 51 >ref|XP_007144463.1| hypothetical protein PHAVU_007G158300g [Phaseolus vulgaris] gi|561017653|gb|ESW16457.1| hypothetical protein PHAVU_007G158300g [Phaseolus vulgaris] Length = 71 Score = 92.0 bits (227), Expect = 7e-17 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = +2 Query: 95 MKFWDWYLKIAVGSALVGGSMEFFMIKTGFYDKVTVLEAEKRAWDNSPEAQ 247 MKF DWYLKI + SALVG SME FMIKTGFYDKVTVLE+EKRAW+NSPEAQ Sbjct: 1 MKFLDWYLKIGIVSALVGASMEVFMIKTGFYDKVTVLESEKRAWENSPEAQ 51 >gb|AFK40452.1| unknown [Lotus japonicus] Length = 71 Score = 91.7 bits (226), Expect = 1e-16 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = +2 Query: 95 MKFWDWYLKIAVGSALVGGSMEFFMIKTGFYDKVTVLEAEKRAWDNSPEAQ 247 MKF DWYLKI V SAL+G SME FMIKTGFYDKVTVLE+EKRAW+NSPEAQ Sbjct: 1 MKFLDWYLKIGVVSALLGASMELFMIKTGFYDKVTVLESEKRAWENSPEAQ 51 >ref|XP_006594081.1| PREDICTED: uncharacterized protein LOC100810605 [Glycine max] Length = 71 Score = 91.7 bits (226), Expect = 1e-16 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = +2 Query: 95 MKFWDWYLKIAVGSALVGGSMEFFMIKTGFYDKVTVLEAEKRAWDNSPEAQ 247 MKF DWYLKI V SALVG SME FMIKTGFYDKVTVLE+EKRAW+NSP+AQ Sbjct: 1 MKFLDWYLKIGVVSALVGASMELFMIKTGFYDKVTVLESEKRAWENSPDAQ 51 >ref|XP_007135195.1| hypothetical protein PHAVU_010G109000g [Phaseolus vulgaris] gi|561008240|gb|ESW07189.1| hypothetical protein PHAVU_010G109000g [Phaseolus vulgaris] Length = 71 Score = 91.3 bits (225), Expect = 1e-16 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = +2 Query: 95 MKFWDWYLKIAVGSALVGGSMEFFMIKTGFYDKVTVLEAEKRAWDNSPEAQ 247 MKF DWYLKI V SALVG SME FMIKTGFYDKVTVLE+EKRAW+NSP+AQ Sbjct: 1 MKFLDWYLKIGVVSALVGASMEVFMIKTGFYDKVTVLESEKRAWENSPDAQ 51 >ref|NP_191804.1| uncharacterized protein [Arabidopsis thaliana] gi|7340716|emb|CAB82959.1| putative protein [Arabidopsis thaliana] gi|26453058|dbj|BAC43605.1| unknown protein [Arabidopsis thaliana] gi|28973503|gb|AAO64076.1| unknown protein [Arabidopsis thaliana] gi|332646833|gb|AEE80354.1| uncharacterized protein AT3G62450 [Arabidopsis thaliana] Length = 74 Score = 90.5 bits (223), Expect = 2e-16 Identities = 40/50 (80%), Positives = 47/50 (94%) Frame = +2 Query: 98 KFWDWYLKIAVGSALVGGSMEFFMIKTGFYDKVTVLEAEKRAWDNSPEAQ 247 +F DWYLKIA+GSA++GG MEFFMIKTGFYDKVTV+EAE+RA +NSPEAQ Sbjct: 5 RFLDWYLKIAIGSAIIGGGMEFFMIKTGFYDKVTVIEAERRALENSPEAQ 54 >ref|XP_002876675.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297322513|gb|EFH52934.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 74 Score = 90.5 bits (223), Expect = 2e-16 Identities = 40/50 (80%), Positives = 47/50 (94%) Frame = +2 Query: 98 KFWDWYLKIAVGSALVGGSMEFFMIKTGFYDKVTVLEAEKRAWDNSPEAQ 247 +F DWYLKIA+GSA++GG MEFFMIKTGFYDKVTV+EAE+RA +NSPEAQ Sbjct: 5 RFLDWYLKIAIGSAIIGGGMEFFMIKTGFYDKVTVIEAERRALENSPEAQ 54 >ref|XP_002516849.1| conserved hypothetical protein [Ricinus communis] gi|223543937|gb|EEF45463.1| conserved hypothetical protein [Ricinus communis] Length = 71 Score = 90.5 bits (223), Expect = 2e-16 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = +2 Query: 95 MKFWDWYLKIAVGSALVGGSMEFFMIKTGFYDKVTVLEAEKRAWDNSPEAQ 247 MKF DWY KIAVGSALVG SME FMIKTGFYDKVTVLE+EKRAW++S EAQ Sbjct: 1 MKFVDWYAKIAVGSALVGASMELFMIKTGFYDKVTVLESEKRAWESSSEAQ 51 >ref|XP_003595500.1| hypothetical protein MTR_2g048470 [Medicago truncatula] gi|355484548|gb|AES65751.1| hypothetical protein MTR_2g048470 [Medicago truncatula] gi|388512627|gb|AFK44375.1| unknown [Medicago truncatula] Length = 71 Score = 89.7 bits (221), Expect = 4e-16 Identities = 42/51 (82%), Positives = 46/51 (90%) Frame = +2 Query: 95 MKFWDWYLKIAVGSALVGGSMEFFMIKTGFYDKVTVLEAEKRAWDNSPEAQ 247 MKF DWYLKI V SALVG SMEFFM+KTGFYDKVTVLE+EKRA +NSP+AQ Sbjct: 1 MKFLDWYLKIGVASALVGASMEFFMVKTGFYDKVTVLESEKRALENSPDAQ 51 >ref|XP_003590509.1| hypothetical protein MTR_1g068580 [Medicago truncatula] gi|355479557|gb|AES60760.1| hypothetical protein MTR_1g068580 [Medicago truncatula] Length = 74 Score = 89.0 bits (219), Expect = 6e-16 Identities = 42/50 (84%), Positives = 45/50 (90%) Frame = +2 Query: 98 KFWDWYLKIAVGSALVGGSMEFFMIKTGFYDKVTVLEAEKRAWDNSPEAQ 247 KF DWYLKI V SALVG SMEFFM+KTGFYDKVTVLE+EKRA +NSPEAQ Sbjct: 5 KFLDWYLKIGVASALVGASMEFFMVKTGFYDKVTVLESEKRALENSPEAQ 54 >ref|NP_001176304.1| Os11g0107450 [Oryza sativa Japonica Group] gi|218185083|gb|EEC67510.1| hypothetical protein OsI_34801 [Oryza sativa Indica Group] gi|255679696|dbj|BAH95032.1| Os11g0107450 [Oryza sativa Japonica Group] Length = 68 Score = 86.3 bits (212), Expect = 4e-15 Identities = 39/51 (76%), Positives = 44/51 (86%) Frame = +2 Query: 95 MKFWDWYLKIAVGSALVGGSMEFFMIKTGFYDKVTVLEAEKRAWDNSPEAQ 247 M+F WYLKIAVG A +G SME FMI TGFY+KVTVLE+EKRAW+NSPEAQ Sbjct: 1 MRFLGWYLKIAVGGAAIGASMELFMIHTGFYEKVTVLESEKRAWENSPEAQ 51 >gb|ABE91880.2| hypothetical protein MtrDRAFT_AC140551g61v2 [Medicago truncatula] Length = 70 Score = 85.5 bits (210), Expect = 7e-15 Identities = 40/49 (81%), Positives = 43/49 (87%) Frame = +2 Query: 101 FWDWYLKIAVGSALVGGSMEFFMIKTGFYDKVTVLEAEKRAWDNSPEAQ 247 F DWY KI V SALVG SMEFFM+KTGFYDKVTVLE+EKRA +NSPEAQ Sbjct: 2 FLDWYFKIGVASALVGASMEFFMVKTGFYDKVTVLESEKRALENSPEAQ 50 >ref|XP_003631961.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase 24-like [Vitis vinifera] Length = 352 Score = 84.3 bits (207), Expect = 2e-14 Identities = 40/51 (78%), Positives = 43/51 (84%) Frame = +2 Query: 95 MKFWDWYLKIAVGSALVGGSMEFFMIKTGFYDKVTVLEAEKRAWDNSPEAQ 247 MKF DWYLKIA SAL+G SME FMIKTGFYDKVTVLE+EK AW+ S EAQ Sbjct: 1 MKFLDWYLKIAAVSALIGASMELFMIKTGFYDKVTVLESEKLAWEGSTEAQ 51 >dbj|BAK06248.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 69 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/51 (72%), Positives = 44/51 (86%) Frame = +2 Query: 95 MKFWDWYLKIAVGSALVGGSMEFFMIKTGFYDKVTVLEAEKRAWDNSPEAQ 247 MKF WY+KIAVG A +G +ME FMI TGFY+KVTVLE+EKRAW++SPEAQ Sbjct: 1 MKFAGWYMKIAVGGAAIGAAMELFMIHTGFYEKVTVLESEKRAWESSPEAQ 51 >ref|XP_003579048.1| PREDICTED: uncharacterized protein LOC100836093 [Brachypodium distachyon] Length = 69 Score = 82.4 bits (202), Expect = 6e-14 Identities = 37/51 (72%), Positives = 43/51 (84%) Frame = +2 Query: 95 MKFWDWYLKIAVGSALVGGSMEFFMIKTGFYDKVTVLEAEKRAWDNSPEAQ 247 M+F WYLKIA G A +G SME FMI TGFY+KVTVLE+EKRAW++SPEAQ Sbjct: 1 MRFAGWYLKIAAGGAAIGASMELFMIHTGFYEKVTVLESEKRAWESSPEAQ 51