BLASTX nr result
ID: Mentha29_contig00025406
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00025406 (224 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19293.1| hypothetical protein MIMGU_mgv1a017958mg [Mimulus... 59 6e-10 gb|EYU40957.1| hypothetical protein MIMGU_mgv11b022113mg [Mimulu... 51 6e-07 ref|XP_002519901.1| pentatricopeptide repeat-containing protein,... 54 3e-06 ref|XP_003534864.1| PREDICTED: pentatricopeptide repeat-containi... 48 6e-06 >gb|EYU19293.1| hypothetical protein MIMGU_mgv1a017958mg [Mimulus guttatus] Length = 383 Score = 59.3 bits (142), Expect(2) = 6e-10 Identities = 29/53 (54%), Positives = 37/53 (69%) Frame = +1 Query: 1 TMLQALFHEGRYDEGLKLFREMKARHVAPDKRT*NILLHGLCRGHRLDEAFSF 159 TM+ LF EGR+ +G KLF +M+AR V P T NIL+ LCR H++ EAFSF Sbjct: 183 TMIHGLFSEGRFADGWKLFNDMEARQVHPGLFTYNILMDVLCRTHQIAEAFSF 235 Score = 30.0 bits (66), Expect(2) = 6e-10 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +3 Query: 156 FLNVMENEGSAPSIVTFNILV 218 FL VMEN+G P I+T+ IL+ Sbjct: 235 FLRVMENKGLNPDIITYGILI 255 >gb|EYU40957.1| hypothetical protein MIMGU_mgv11b022113mg [Mimulus guttatus] Length = 233 Score = 51.2 bits (121), Expect(2) = 6e-07 Identities = 27/53 (50%), Positives = 33/53 (62%) Frame = +1 Query: 1 TMLQALFHEGRYDEGLKLFREMKARHVAPDKRT*NILLHGLCRGHRLDEAFSF 159 TM+ LF EGR +G KLF M+AR V P T NIL+ LC ++ EAFSF Sbjct: 60 TMIHGLFSEGRIADGWKLFNHMEARKVHPSICTYNILMECLCGTRKIVEAFSF 112 Score = 27.7 bits (60), Expect(2) = 6e-07 Identities = 9/21 (42%), Positives = 19/21 (90%) Frame = +3 Query: 156 FLNVMENEGSAPSIVTFNILV 218 F+ VME++G +P+I+T++I++ Sbjct: 112 FVRVMEDKGVSPNIITYDIVI 132 >ref|XP_002519901.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223540947|gb|EEF42505.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 777 Score = 53.9 bits (128), Expect(2) = 3e-06 Identities = 26/53 (49%), Positives = 36/53 (67%) Frame = +1 Query: 1 TMLQALFHEGRYDEGLKLFREMKARHVAPDKRT*NILLHGLCRGHRLDEAFSF 159 TM+ A GR D+ ++LFR+M+ VAP+ T N ++HGLC+ RLDEAF F Sbjct: 202 TMVNAFCTGGRVDDAIELFRKMEKVGVAPNVVTYNNIIHGLCKNGRLDEAFQF 254 Score = 22.7 bits (47), Expect(2) = 3e-06 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 156 FLNVMENEGSAPSIVTFNILV 218 F ME E PS+VT+ +L+ Sbjct: 254 FKEKMEKERVKPSLVTYGVLI 274 >ref|XP_003534864.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like isoform X1 [Glycine max] gi|571476386|ref|XP_006586943.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like isoform X2 [Glycine max] gi|571476388|ref|XP_006586944.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like isoform X3 [Glycine max] gi|571476390|ref|XP_006586945.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like isoform X4 [Glycine max] gi|571476393|ref|XP_006586946.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like isoform X5 [Glycine max] gi|571476395|ref|XP_006586947.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like isoform X6 [Glycine max] Length = 642 Score = 48.1 bits (113), Expect(2) = 6e-06 Identities = 21/51 (41%), Positives = 35/51 (68%) Frame = +1 Query: 4 MLQALFHEGRYDEGLKLFREMKARHVAPDKRT*NILLHGLCRGHRLDEAFS 156 +++A+ G D+ +++FRE+ R+ APD T + L+HGLC+ R+DEA S Sbjct: 176 VIKAMCRLGLVDKAIEVFREIPLRNCAPDNYTYSTLMHGLCKEERIDEAVS 226 Score = 27.3 bits (59), Expect(2) = 6e-06 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = +3 Query: 147 SIFFLNVMENEGSAPSIVTFNILVGA 224 ++ L+ M+ EG+ P++V FN+L+ A Sbjct: 224 AVSLLDEMQVEGTFPNLVAFNVLISA 249