BLASTX nr result
ID: Mentha29_contig00025227
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00025227 (323 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18818.1| hypothetical protein MIMGU_mgv1a022162mg [Mimulus... 64 2e-08 >gb|EYU18818.1| hypothetical protein MIMGU_mgv1a022162mg [Mimulus guttatus] Length = 338 Score = 64.3 bits (155), Expect = 2e-08 Identities = 35/56 (62%), Positives = 42/56 (75%), Gaps = 5/56 (8%) Frame = -3 Query: 318 VAVVGMGFYSYFCTNETKRKPVADV--LPPMKDQKDANSPLLA---QDKESKDSAV 166 +A+VGMG YSYFCTNETKRK + DV +P MK++ +PLLA QDKESKDS V Sbjct: 285 IAIVGMGMYSYFCTNETKRKVIVDVSTMPQMKERD--TTPLLASHLQDKESKDSVV 338