BLASTX nr result
ID: Mentha29_contig00025103
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00025103 (279 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22829.1| hypothetical protein MIMGU_mgv1a002344mg [Mimulus... 62 1e-07 >gb|EYU22829.1| hypothetical protein MIMGU_mgv1a002344mg [Mimulus guttatus] Length = 686 Score = 61.6 bits (148), Expect = 1e-07 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -3 Query: 100 MATASQLHCPFPQTANKTPFLGPKTVKRTPFL 5 MAT +Q+HCPFPQT NKTPF GPKT+K+TPF+ Sbjct: 1 MATTAQIHCPFPQTGNKTPFPGPKTIKKTPFI 32