BLASTX nr result
ID: Mentha29_contig00025034
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00025034 (604 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB54049.1| hypothetical protein L484_001387 [Morus notabilis] 59 1e-06 >gb|EXB54049.1| hypothetical protein L484_001387 [Morus notabilis] Length = 143 Score = 58.5 bits (140), Expect = 1e-06 Identities = 39/116 (33%), Positives = 61/116 (52%), Gaps = 5/116 (4%) Frame = +3 Query: 57 LTFLQHVTPGQQS----KPKVQQFILREDLNXXXXXXXXXXXXXHFE-SKPLIQNDEISK 221 +TF ++P +++ K + I R++L+ E S+PLI+ + K Sbjct: 6 VTFYNRISPDEKALEHRKSNAKSIIYRDELSKTKQAKRKPKKGDSLEFSEPLIEKESGVK 65 Query: 222 KHTDEGENAKEGKVSREKPAVQVKILMTKEEANRLLSKCKKNGGTLQFEDVANLLV 389 + E + G ++VK+ MTKEEANRLLS+C K+GG L+F+DVA LV Sbjct: 66 TVSSRAEEERSG-------VIRVKVTMTKEEANRLLSRC-KDGGVLKFKDVARELV 113