BLASTX nr result
ID: Mentha29_contig00025010
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00025010 (344 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39197.1| hypothetical protein MIMGU_mgv1a002547mg [Mimulus... 60 2e-07 >gb|EYU39197.1| hypothetical protein MIMGU_mgv1a002547mg [Mimulus guttatus] Length = 660 Score = 60.5 bits (145), Expect = 2e-07 Identities = 33/62 (53%), Positives = 39/62 (62%), Gaps = 2/62 (3%) Frame = +3 Query: 3 LNAXXXXXXXXXXXXSGKGARKAGPLTLMLSKFSAKLRGKPWEPPKPSESG--RSNTKYK 176 LNA GKGA K GPL+L+LS+ SAKLRGK WEPPKPS S +S+ YK Sbjct: 582 LNALRRRRGEEERLLKGKGAEK-GPLSLLLSRLSAKLRGKQWEPPKPSSSSSKKSSVNYK 640 Query: 177 LI 182 L+ Sbjct: 641 LV 642