BLASTX nr result
ID: Mentha29_contig00024713
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00024713 (263 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36505.1| hypothetical protein MIMGU_mgv1a012146mg [Mimulus... 67 2e-09 ref|XP_006472615.1| PREDICTED: serine/arginine-rich splicing fac... 67 2e-09 ref|XP_006433997.1| hypothetical protein CICLE_v10002266mg [Citr... 67 2e-09 ref|XP_002302293.2| hypothetical protein POPTR_0002s09630g [Popu... 67 2e-09 ref|XP_006383495.1| hypothetical protein POPTR_0005s17020g [Popu... 67 2e-09 ref|XP_006383494.1| hypothetical protein POPTR_0005s17020g [Popu... 67 2e-09 gb|ABK94120.1| unknown [Populus trichocarpa] 67 2e-09 gb|EXC06736.1| Serine/arginine-rich splicing factor 2 [Morus not... 66 4e-09 ref|XP_006849807.1| hypothetical protein AMTR_s00176p00054790 [A... 66 4e-09 ref|XP_004300636.1| PREDICTED: uncharacterized protein LOC101307... 66 4e-09 ref|XP_007223283.1| hypothetical protein PRUPE_ppa009468mg [Prun... 66 4e-09 ref|XP_004171401.1| PREDICTED: uncharacterized LOC101216322 [Cuc... 66 4e-09 ref|XP_004143002.1| PREDICTED: uncharacterized protein LOC101216... 66 4e-09 ref|XP_002274860.1| PREDICTED: uncharacterized protein LOC100242... 66 4e-09 ref|XP_002285794.1| PREDICTED: uncharacterized protein LOC100243... 66 4e-09 ref|XP_006659519.1| PREDICTED: serine/arginine-rich splicing fac... 66 6e-09 ref|XP_004973753.1| PREDICTED: serine/arginine-rich splicing fac... 66 6e-09 gb|AGE46128.1| arginine/serine-rich splicing factor SC31 transcr... 66 6e-09 gb|AGE46127.1| arginine/serine-rich splicing factor SC31 transcr... 66 6e-09 gb|AGE46126.1| arginine/serine-rich splicing factor SC31 transcr... 66 6e-09 >gb|EYU36505.1| hypothetical protein MIMGU_mgv1a012146mg [Mimulus guttatus] Length = 260 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 166 MSHFGKSGPPDIRDTFSLLVLNITFRTTADDL 261 MSHFG+SGPPDIRDTFSLLVLNITFRTTADDL Sbjct: 1 MSHFGRSGPPDIRDTFSLLVLNITFRTTADDL 32 >ref|XP_006472615.1| PREDICTED: serine/arginine-rich splicing factor 2-like [Citrus sinensis] Length = 251 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 166 MSHFGKSGPPDIRDTFSLLVLNITFRTTADDL 261 MSHFGKSGPPDIRDT+SLLVLNITFRTTADDL Sbjct: 1 MSHFGKSGPPDIRDTYSLLVLNITFRTTADDL 32 >ref|XP_006433997.1| hypothetical protein CICLE_v10002266mg [Citrus clementina] gi|567882879|ref|XP_006433998.1| hypothetical protein CICLE_v10002266mg [Citrus clementina] gi|557536119|gb|ESR47237.1| hypothetical protein CICLE_v10002266mg [Citrus clementina] gi|557536120|gb|ESR47238.1| hypothetical protein CICLE_v10002266mg [Citrus clementina] Length = 251 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 166 MSHFGKSGPPDIRDTFSLLVLNITFRTTADDL 261 MSHFGKSGPPDIRDT+SLLVLNITFRTTADDL Sbjct: 1 MSHFGKSGPPDIRDTYSLLVLNITFRTTADDL 32 >ref|XP_002302293.2| hypothetical protein POPTR_0002s09630g [Populus trichocarpa] gi|550344654|gb|EEE81566.2| hypothetical protein POPTR_0002s09630g [Populus trichocarpa] Length = 235 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 166 MSHFGKSGPPDIRDTFSLLVLNITFRTTADDL 261 MSHFG+SGPPDIRDTFSLLVLNITFRTTADDL Sbjct: 1 MSHFGRSGPPDIRDTFSLLVLNITFRTTADDL 32 >ref|XP_006383495.1| hypothetical protein POPTR_0005s17020g [Populus trichocarpa] gi|566171807|ref|XP_002306575.2| hypothetical protein POPTR_0005s17020g [Populus trichocarpa] gi|550339146|gb|ERP61292.1| hypothetical protein POPTR_0005s17020g [Populus trichocarpa] gi|550339147|gb|EEE93571.2| hypothetical protein POPTR_0005s17020g [Populus trichocarpa] Length = 270 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 166 MSHFGKSGPPDIRDTFSLLVLNITFRTTADDL 261 MSHFG+SGPPDIRDTFSLLVLNITFRTTADDL Sbjct: 1 MSHFGRSGPPDIRDTFSLLVLNITFRTTADDL 32 >ref|XP_006383494.1| hypothetical protein POPTR_0005s17020g [Populus trichocarpa] gi|550339145|gb|ERP61291.1| hypothetical protein POPTR_0005s17020g [Populus trichocarpa] Length = 238 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 166 MSHFGKSGPPDIRDTFSLLVLNITFRTTADDL 261 MSHFG+SGPPDIRDTFSLLVLNITFRTTADDL Sbjct: 1 MSHFGRSGPPDIRDTFSLLVLNITFRTTADDL 32 >gb|ABK94120.1| unknown [Populus trichocarpa] Length = 302 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 166 MSHFGKSGPPDIRDTFSLLVLNITFRTTADDL 261 MSHFG+SGPPDIRDTFSLLVLNITFRTTADDL Sbjct: 1 MSHFGRSGPPDIRDTFSLLVLNITFRTTADDL 32 >gb|EXC06736.1| Serine/arginine-rich splicing factor 2 [Morus notabilis] Length = 295 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +1 Query: 166 MSHFGKSGPPDIRDTFSLLVLNITFRTTADDL 261 MSHFG+SGPPDIRDT+SLLVLNITFRTTADDL Sbjct: 1 MSHFGRSGPPDIRDTYSLLVLNITFRTTADDL 32 >ref|XP_006849807.1| hypothetical protein AMTR_s00176p00054790 [Amborella trichopoda] gi|548853384|gb|ERN11388.1| hypothetical protein AMTR_s00176p00054790 [Amborella trichopoda] Length = 258 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +1 Query: 166 MSHFGKSGPPDIRDTFSLLVLNITFRTTADDL 261 MSHFG+SGPPDI+DTFSLLVLNITFRTTADDL Sbjct: 1 MSHFGRSGPPDIKDTFSLLVLNITFRTTADDL 32 >ref|XP_004300636.1| PREDICTED: uncharacterized protein LOC101307796 [Fragaria vesca subsp. vesca] Length = 253 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +1 Query: 166 MSHFGKSGPPDIRDTFSLLVLNITFRTTADDL 261 MSHFG+SGPPDIRDT+SLLVLNITFRTTADDL Sbjct: 1 MSHFGRSGPPDIRDTYSLLVLNITFRTTADDL 32 >ref|XP_007223283.1| hypothetical protein PRUPE_ppa009468mg [Prunus persica] gi|462420219|gb|EMJ24482.1| hypothetical protein PRUPE_ppa009468mg [Prunus persica] Length = 291 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +1 Query: 166 MSHFGKSGPPDIRDTFSLLVLNITFRTTADDL 261 MSHFG+SGPPDIRDT+SLLVLNITFRTTADDL Sbjct: 1 MSHFGRSGPPDIRDTYSLLVLNITFRTTADDL 32 >ref|XP_004171401.1| PREDICTED: uncharacterized LOC101216322 [Cucumis sativus] Length = 251 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +1 Query: 166 MSHFGKSGPPDIRDTFSLLVLNITFRTTADDL 261 MSHFG+SGPPDIRDT+SLLVLNITFRTTADDL Sbjct: 1 MSHFGRSGPPDIRDTYSLLVLNITFRTTADDL 32 >ref|XP_004143002.1| PREDICTED: uncharacterized protein LOC101216322 [Cucumis sativus] Length = 257 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +1 Query: 166 MSHFGKSGPPDIRDTFSLLVLNITFRTTADDL 261 MSHFG+SGPPDIRDT+SLLVLNITFRTTADDL Sbjct: 1 MSHFGRSGPPDIRDTYSLLVLNITFRTTADDL 32 >ref|XP_002274860.1| PREDICTED: uncharacterized protein LOC100242306 [Vitis vinifera] gi|296086805|emb|CBI32954.3| unnamed protein product [Vitis vinifera] Length = 255 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +1 Query: 166 MSHFGKSGPPDIRDTFSLLVLNITFRTTADDL 261 MSHFG+SGPPDI+DTFSLLVLNITFRTTADDL Sbjct: 1 MSHFGRSGPPDIKDTFSLLVLNITFRTTADDL 32 >ref|XP_002285794.1| PREDICTED: uncharacterized protein LOC100243776 [Vitis vinifera] gi|302141951|emb|CBI19154.3| unnamed protein product [Vitis vinifera] Length = 257 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +1 Query: 166 MSHFGKSGPPDIRDTFSLLVLNITFRTTADDL 261 MSHFG+SGPPDIRDT+SLLVLNITFRTTADDL Sbjct: 1 MSHFGRSGPPDIRDTYSLLVLNITFRTTADDL 32 >ref|XP_006659519.1| PREDICTED: serine/arginine-rich splicing factor 2-like [Oryza brachyantha] Length = 293 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +1 Query: 166 MSHFGKSGPPDIRDTFSLLVLNITFRTTADDL 261 MSHFG+SGPPDIRDTFSLLVLNI+FRTTADDL Sbjct: 1 MSHFGRSGPPDIRDTFSLLVLNISFRTTADDL 32 >ref|XP_004973753.1| PREDICTED: serine/arginine-rich splicing factor 2-like [Setaria italica] Length = 290 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +1 Query: 166 MSHFGKSGPPDIRDTFSLLVLNITFRTTADDL 261 MSHFG+SGPPDIRDTFSLLVLNI+FRTTADDL Sbjct: 1 MSHFGRSGPPDIRDTFSLLVLNISFRTTADDL 32 >gb|AGE46128.1| arginine/serine-rich splicing factor SC31 transcript VI [Sorghum bicolor] Length = 107 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +1 Query: 166 MSHFGKSGPPDIRDTFSLLVLNITFRTTADDL 261 MSHFG+SGPPDIRDTFSLLVLNI+FRTTADDL Sbjct: 1 MSHFGRSGPPDIRDTFSLLVLNISFRTTADDL 32 >gb|AGE46127.1| arginine/serine-rich splicing factor SC31 transcript V [Sorghum bicolor] Length = 185 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +1 Query: 166 MSHFGKSGPPDIRDTFSLLVLNITFRTTADDL 261 MSHFG+SGPPDIRDTFSLLVLNI+FRTTADDL Sbjct: 1 MSHFGRSGPPDIRDTFSLLVLNISFRTTADDL 32 >gb|AGE46126.1| arginine/serine-rich splicing factor SC31 transcript IV [Sorghum bicolor] Length = 273 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +1 Query: 166 MSHFGKSGPPDIRDTFSLLVLNITFRTTADDL 261 MSHFG+SGPPDIRDTFSLLVLNI+FRTTADDL Sbjct: 1 MSHFGRSGPPDIRDTFSLLVLNISFRTTADDL 32