BLASTX nr result
ID: Mentha29_contig00024531
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00024531 (235 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46182.1| hypothetical protein MIMGU_mgv1a026233mg [Mimulus... 75 7e-12 >gb|EYU46182.1| hypothetical protein MIMGU_mgv1a026233mg [Mimulus guttatus] Length = 305 Score = 75.5 bits (184), Expect = 7e-12 Identities = 34/40 (85%), Positives = 35/40 (87%) Frame = +3 Query: 102 SGPLDFKGSAYARWVRDQTRHGLSPRSPSSFLFRQRVRPL 221 SGPLDFKGSAYARWVRDQTR GLSP+ P F FRQRVRPL Sbjct: 164 SGPLDFKGSAYARWVRDQTREGLSPKRPKRFFFRQRVRPL 203