BLASTX nr result
ID: Mentha29_contig00023172
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00023172 (252 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006577380.1| PREDICTED: ATP-dependent DNA helicase PIF1-l... 55 1e-05 >ref|XP_006577380.1| PREDICTED: ATP-dependent DNA helicase PIF1-like [Glycine max] Length = 345 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/72 (38%), Positives = 43/72 (59%), Gaps = 5/72 (6%) Frame = -1 Query: 225 AGRWGLAHSLRHLFAK-----SMNRPEIVWEKCWKYLSDDILYTQRKRLGQPGICQLI*F 61 A WG+AH LR LF K +M+RPE VW++ W++++DDI + RK+ Q I I Sbjct: 48 ANNWGIAHYLRKLFVKLLFMNTMDRPEYVWQQTWQWMADDIRFNNRKQDEQKTIVDTIIR 107 Query: 60 MIHHYISFVYKL 25 +++ + VY L Sbjct: 108 VVNTQSAAVYFL 119