BLASTX nr result
ID: Mentha29_contig00023155
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00023155 (459 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU30874.1| hypothetical protein MIMGU_mgv1a0161591mg, partia... 70 3e-10 ref|XP_006397221.1| hypothetical protein EUTSA_v10029093mg [Eutr... 68 1e-09 gb|AFK44300.1| unknown [Lotus japonicus] 68 2e-09 gb|AFK42674.1| unknown [Medicago truncatula] 68 2e-09 ref|XP_003614178.1| Receptor-like protein kinase [Medicago trunc... 68 2e-09 ref|XP_002872362.1| predicted protein [Arabidopsis lyrata subsp.... 67 3e-09 ref|XP_002531113.1| conserved hypothetical protein [Ricinus comm... 67 3e-09 ref|XP_002308991.1| hypothetical protein POPTR_0006s07000g [Popu... 67 3e-09 ref|XP_004491078.1| PREDICTED: 39S ribosomal protein L41-A, mito... 66 4e-09 ref|XP_006284842.1| hypothetical protein CARUB_v10006124mg [Caps... 66 6e-09 ref|NP_198824.1| mitochondrial ribosomal protein L27 [Arabidopsi... 65 8e-09 ref|NP_568574.1| mitochondrial ribosomal protein L27 [Arabidopsi... 65 8e-09 ref|XP_006482591.1| PREDICTED: 39S ribosomal protein L41-A, mito... 65 8e-09 gb|EPS72670.1| hypothetical protein M569_02087, partial [Genlise... 65 8e-09 dbj|BAB11384.1| unnamed protein product [Arabidopsis thaliana] 65 8e-09 gb|AAM63883.1| unknown [Arabidopsis thaliana] 65 8e-09 ref|XP_004953117.1| PREDICTED: 39S ribosomal protein L41-A, mito... 65 1e-08 ref|XP_002442561.1| hypothetical protein SORBIDRAFT_08g021960 [S... 65 1e-08 ref|XP_002306562.1| hypothetical protein POPTR_0005s17380g [Popu... 65 1e-08 ref|XP_004135839.1| PREDICTED: 39S ribosomal protein L41-A, mito... 65 1e-08 >gb|EYU30874.1| hypothetical protein MIMGU_mgv1a0161591mg, partial [Mimulus guttatus] Length = 38 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -3 Query: 454 GYVVVPEKLPNYVVPDLTGFKLKPYVSQCAREASESTK 341 GYVVVPEKLPNYVVPDL+GFKLKPYVSQCA + ++S K Sbjct: 1 GYVVVPEKLPNYVVPDLSGFKLKPYVSQCAPQVADSAK 38 >ref|XP_006397221.1| hypothetical protein EUTSA_v10029093mg [Eutrema salsugineum] gi|567164036|ref|XP_006397222.1| hypothetical protein EUTSA_v10029093mg [Eutrema salsugineum] gi|567164039|ref|XP_006397223.1| hypothetical protein EUTSA_v10029093mg [Eutrema salsugineum] gi|557098238|gb|ESQ38674.1| hypothetical protein EUTSA_v10029093mg [Eutrema salsugineum] gi|557098239|gb|ESQ38675.1| hypothetical protein EUTSA_v10029093mg [Eutrema salsugineum] gi|557098240|gb|ESQ38676.1| hypothetical protein EUTSA_v10029093mg [Eutrema salsugineum] Length = 93 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -3 Query: 457 GGYVVVPEKLPNYVVPDLTGFKLKPYVSQCAREASESTK 341 GGYVV P+KLPNYVVPDLTGFKLKPYVSQC E +++T+ Sbjct: 49 GGYVVQPDKLPNYVVPDLTGFKLKPYVSQCPIEVNKTTE 87 >gb|AFK44300.1| unknown [Lotus japonicus] Length = 92 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = -3 Query: 457 GGYVVVPEKLPNYVVPDLTGFKLKPYVSQCAREASES 347 GGYVVVPEKLP YVVPDLT FKLKPYVSQC RE + S Sbjct: 49 GGYVVVPEKLPKYVVPDLTDFKLKPYVSQCPREVNTS 85 >gb|AFK42674.1| unknown [Medicago truncatula] Length = 92 Score = 67.8 bits (164), Expect = 2e-09 Identities = 32/37 (86%), Positives = 32/37 (86%) Frame = -3 Query: 457 GGYVVVPEKLPNYVVPDLTGFKLKPYVSQCAREASES 347 GGYVVV EKLPNYVVPDLTGFKLKPYVSQC EA S Sbjct: 49 GGYVVVKEKLPNYVVPDLTGFKLKPYVSQCPIEAKTS 85 >ref|XP_003614178.1| Receptor-like protein kinase [Medicago truncatula] gi|355515513|gb|AES97136.1| Receptor-like protein kinase [Medicago truncatula] Length = 1243 Score = 67.8 bits (164), Expect = 2e-09 Identities = 32/37 (86%), Positives = 32/37 (86%) Frame = -3 Query: 457 GGYVVVPEKLPNYVVPDLTGFKLKPYVSQCAREASES 347 GGYVVV EKLPNYVVPDLTGFKLKPYVSQC EA S Sbjct: 1200 GGYVVVKEKLPNYVVPDLTGFKLKPYVSQCPIEAKTS 1236 >ref|XP_002872362.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297318199|gb|EFH48621.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 93 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -3 Query: 457 GGYVVVPEKLPNYVVPDLTGFKLKPYVSQCAREASESTK 341 GGYVV P KLPNYVVPDLTGFKLKPYVSQC + +++T+ Sbjct: 49 GGYVVQPHKLPNYVVPDLTGFKLKPYVSQCPLDVNKTTE 87 >ref|XP_002531113.1| conserved hypothetical protein [Ricinus communis] gi|223529309|gb|EEF31278.1| conserved hypothetical protein [Ricinus communis] Length = 92 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 457 GGYVVVPEKLPNYVVPDLTGFKLKPYVSQCARE 359 GGYV+VPEKLPNYVVPDLT FKLKPYVSQCA + Sbjct: 49 GGYVIVPEKLPNYVVPDLTDFKLKPYVSQCATQ 81 >ref|XP_002308991.1| hypothetical protein POPTR_0006s07000g [Populus trichocarpa] gi|222854967|gb|EEE92514.1| hypothetical protein POPTR_0006s07000g [Populus trichocarpa] Length = 92 Score = 66.6 bits (161), Expect = 3e-09 Identities = 34/44 (77%), Positives = 34/44 (77%), Gaps = 5/44 (11%) Frame = -3 Query: 457 GGYVVVPEKLPNYVVPDLTGFKLKPYVSQC-----AREASESTK 341 GGYVVVPEKLPNYVVPDLT FKLKPYVSQC EASE K Sbjct: 49 GGYVVVPEKLPNYVVPDLTDFKLKPYVSQCPTEVKTTEASELAK 92 >ref|XP_004491078.1| PREDICTED: 39S ribosomal protein L41-A, mitochondrial-like isoform X1 [Cicer arietinum] gi|502097779|ref|XP_004491079.1| PREDICTED: 39S ribosomal protein L41-A, mitochondrial-like isoform X2 [Cicer arietinum] Length = 92 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = -3 Query: 457 GGYVVVPEKLPNYVVPDLTGFKLKPYVSQCAREASES 347 GGYV++ EKLPNYVVPDLTGFKLKPYVSQC EA S Sbjct: 49 GGYVILQEKLPNYVVPDLTGFKLKPYVSQCPIEAKTS 85 >ref|XP_006284842.1| hypothetical protein CARUB_v10006124mg [Capsella rubella] gi|482553547|gb|EOA17740.1| hypothetical protein CARUB_v10006124mg [Capsella rubella] Length = 94 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 2/41 (4%) Frame = -3 Query: 457 GGYVVVPEKLPNYVVPDLTGFKLKPYVSQCARE--ASESTK 341 GGYVV P+KLPNYVVPDLTGFKLKPYVSQC + +ESTK Sbjct: 51 GGYVVQPDKLPNYVVPDLTGFKLKPYVSQCPIKVNTNESTK 91 >ref|NP_198824.1| mitochondrial ribosomal protein L27 [Arabidopsis thaliana] gi|8843807|dbj|BAA97355.1| unnamed protein product [Arabidopsis thaliana] gi|88900316|gb|ABD57470.1| At5g40080 [Arabidopsis thaliana] gi|332007125|gb|AED94508.1| mitochondrial ribosomal protein L27 [Arabidopsis thaliana] Length = 94 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/44 (70%), Positives = 36/44 (81%), Gaps = 5/44 (11%) Frame = -3 Query: 457 GGYVVVPEKLPNYVVPDLTGFKLKPYVSQC-----AREASESTK 341 GGYVV P+KLPNYVVPDLTGFKLKPYVSQC E++E++K Sbjct: 51 GGYVVQPDKLPNYVVPDLTGFKLKPYVSQCPLQVNTNESTEASK 94 >ref|NP_568574.1| mitochondrial ribosomal protein L27 [Arabidopsis thaliana] gi|26451185|dbj|BAC42696.1| unknown protein [Arabidopsis thaliana] gi|28973095|gb|AAO63872.1| unknown protein [Arabidopsis thaliana] gi|332007094|gb|AED94477.1| mitochondrial ribosomal protein L27 [Arabidopsis thaliana] Length = 94 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/44 (70%), Positives = 36/44 (81%), Gaps = 5/44 (11%) Frame = -3 Query: 457 GGYVVVPEKLPNYVVPDLTGFKLKPYVSQC-----AREASESTK 341 GGYVV P+KLPNYVVPDLTGFKLKPYVSQC E++E++K Sbjct: 51 GGYVVQPDKLPNYVVPDLTGFKLKPYVSQCPIQVNTNESTEASK 94 >ref|XP_006482591.1| PREDICTED: 39S ribosomal protein L41-A, mitochondrial-like [Citrus sinensis] Length = 93 Score = 65.5 bits (158), Expect = 8e-09 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 457 GGYVVVPEKLPNYVVPDLTGFKLKPYVSQCARE 359 GGYVVV EKLPNYVVPDLT FKLKPYVSQC RE Sbjct: 49 GGYVVVQEKLPNYVVPDLTDFKLKPYVSQCPRE 81 >gb|EPS72670.1| hypothetical protein M569_02087, partial [Genlisea aurea] Length = 80 Score = 65.5 bits (158), Expect = 8e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -3 Query: 457 GGYVVVPEKLPNYVVPDLTGFKLKPYVSQC 368 GGYVVVPEKLP YVVPDLTGFKLKPYVSQC Sbjct: 50 GGYVVVPEKLPQYVVPDLTGFKLKPYVSQC 79 >dbj|BAB11384.1| unnamed protein product [Arabidopsis thaliana] Length = 86 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/44 (70%), Positives = 36/44 (81%), Gaps = 5/44 (11%) Frame = -3 Query: 457 GGYVVVPEKLPNYVVPDLTGFKLKPYVSQC-----AREASESTK 341 GGYVV P+KLPNYVVPDLTGFKLKPYVSQC E++E++K Sbjct: 43 GGYVVQPDKLPNYVVPDLTGFKLKPYVSQCPIQVNTNESTEASK 86 >gb|AAM63883.1| unknown [Arabidopsis thaliana] Length = 94 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/44 (70%), Positives = 36/44 (81%), Gaps = 5/44 (11%) Frame = -3 Query: 457 GGYVVVPEKLPNYVVPDLTGFKLKPYVSQC-----AREASESTK 341 GGYVV P+KLPNYVVPDLTGFKLKPYVSQC E++E++K Sbjct: 51 GGYVVQPDKLPNYVVPDLTGFKLKPYVSQCPLQVNTNESTEASK 94 >ref|XP_004953117.1| PREDICTED: 39S ribosomal protein L41-A, mitochondrial-like isoform X1 [Setaria italica] gi|514714927|ref|XP_004953118.1| PREDICTED: 39S ribosomal protein L41-A, mitochondrial-like isoform X2 [Setaria italica] Length = 100 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -3 Query: 457 GGYVVVPEKLPNYVVPDLTGFKLKPYVSQCAREASEST 344 GGYV+V EKLP +VVPDLT FKLKPYVSQCAR+ + ST Sbjct: 50 GGYVIVDEKLPRFVVPDLTDFKLKPYVSQCARDLTAST 87 >ref|XP_002442561.1| hypothetical protein SORBIDRAFT_08g021960 [Sorghum bicolor] gi|241943254|gb|EES16399.1| hypothetical protein SORBIDRAFT_08g021960 [Sorghum bicolor] Length = 99 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -3 Query: 457 GGYVVVPEKLPNYVVPDLTGFKLKPYVSQCAREASEST 344 GGYV+V EKLP +VVPDLT FKLKPYVSQCAR+ + ST Sbjct: 50 GGYVIVDEKLPRFVVPDLTDFKLKPYVSQCARDLTAST 87 >ref|XP_002306562.1| hypothetical protein POPTR_0005s17380g [Populus trichocarpa] gi|222856011|gb|EEE93558.1| hypothetical protein POPTR_0005s17380g [Populus trichocarpa] Length = 92 Score = 65.1 bits (157), Expect = 1e-08 Identities = 33/44 (75%), Positives = 34/44 (77%), Gaps = 5/44 (11%) Frame = -3 Query: 457 GGYVVVPEKLPNYVVPDLTGFKLKPYVSQC-----AREASESTK 341 GGYVVVPEKLPNYVVPDLT F LKP+VSQC EASES K Sbjct: 49 GGYVVVPEKLPNYVVPDLTDFMLKPFVSQCQTDVKTTEASESAK 92 >ref|XP_004135839.1| PREDICTED: 39S ribosomal protein L41-A, mitochondrial-like [Cucumis sativus] gi|449490988|ref|XP_004158767.1| PREDICTED: 39S ribosomal protein L41-A, mitochondrial-like [Cucumis sativus] Length = 93 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = -3 Query: 457 GGYVVVPEKLPNYVVPDLTGFKLKPYVSQCAREASES 347 GGYVVVPEKLPNYVVPDL+ FKLKPYVSQC E S Sbjct: 49 GGYVVVPEKLPNYVVPDLSDFKLKPYVSQCPIELKTS 85