BLASTX nr result
ID: Mentha29_contig00023121
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00023121 (299 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35529.1| hypothetical protein MIMGU_mgv1a025365mg [Mimulus... 56 5e-06 >gb|EYU35529.1| hypothetical protein MIMGU_mgv1a025365mg [Mimulus guttatus] Length = 336 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = -3 Query: 297 ERRERKQRTEGALDMFCVAFGVSIFVAFCCFVCYR 193 ERRERK R E ALDMF VAFG+S+FV FCCF+ R Sbjct: 302 ERRERKLRVESALDMFSVAFGISLFVGFCCFLLCR 336