BLASTX nr result
ID: Mentha29_contig00022376
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00022376 (219 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18729.1| hypothetical protein MIMGU_mgv1a001312mg [Mimulus... 59 9e-07 >gb|EYU18729.1| hypothetical protein MIMGU_mgv1a001312mg [Mimulus guttatus] Length = 842 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/56 (53%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Frame = -1 Query: 219 PSAQMYKGIEFFAQTSSGSENAAAIRERLDALKSKYGYSTAEDEN-NPSLPTNALI 55 PS QMY I +A TS+G EN AAIRER+++LK K GYS + + +P LP N+LI Sbjct: 784 PSPQMYNNILSYAHTSAGPENGAAIRERIESLKRKSGYSLLKSKGCDPPLPANSLI 839