BLASTX nr result
ID: Mentha29_contig00022306
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00022306 (559 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516095.1| nutrient reservoir, putative [Ricinus commun... 56 5e-06 >ref|XP_002516095.1| nutrient reservoir, putative [Ricinus communis] gi|223544581|gb|EEF46097.1| nutrient reservoir, putative [Ricinus communis] Length = 139 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/63 (42%), Positives = 35/63 (55%), Gaps = 10/63 (15%) Frame = +3 Query: 156 VLSMLLLAS-NSEDEKSIAPSGSSCTSHCETCPVVCSPP---------QRPPKHHHSPPE 305 ++ M+L A SE++ A +G C S C TCPV+CSPP PP HH SPP+ Sbjct: 23 IMGMILFARVKSEEDDDQAAAGLLCISDCSTCPVICSPPPPPQPHYENPPPPSHHSSPPQ 82 Query: 306 SDY 314 S Y Sbjct: 83 SSY 85