BLASTX nr result
ID: Mentha29_contig00022220
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00022220 (674 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43149.1| hypothetical protein MIMGU_mgv1a000121mg [Mimulus... 57 4e-06 >gb|EYU43149.1| hypothetical protein MIMGU_mgv1a000121mg [Mimulus guttatus] Length = 1722 Score = 57.4 bits (137), Expect = 4e-06 Identities = 31/73 (42%), Positives = 34/73 (46%), Gaps = 3/73 (4%) Frame = +1 Query: 313 VHASLCGEDLVLREDFVVRCPYPKCYNGKVCYRHIYFCTER---GCRLCNSMLELVKFHA 483 VHAS C L C YP C K +RH C R GC LC M L++ HA Sbjct: 1622 VHASQCRSSL---------CQYPNCRKVKGLFRHGMLCKVRASAGCPLCKKMWYLLQIHA 1672 Query: 484 GQCTAPNCMVPRC 522 C PNC VPRC Sbjct: 1673 RACKDPNCNVPRC 1685