BLASTX nr result
ID: Mentha29_contig00022156
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00022156 (599 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38146.1| hypothetical protein MIMGU_mgv1a018623mg [Mimulus... 66 6e-09 ref|XP_007050650.1| Outer envelope membrane protein 7 [Theobroma... 60 6e-07 gb|EPS72563.1| hypothetical protein M569_02199, partial [Genlise... 59 1e-06 ref|XP_002306767.1| outer envelope membrane family protein [Popu... 56 7e-06 >gb|EYU38146.1| hypothetical protein MIMGU_mgv1a018623mg [Mimulus guttatus] Length = 77 Score = 66.2 bits (160), Expect = 6e-09 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = +1 Query: 178 MAKQNSTKSAAIVFGALAFGWLAIEMALKPLLVKARSAMN 297 MAK +S KSA IVFGALAFGWLAIE+ALKP LVKARSAM+ Sbjct: 1 MAKSSSAKSAGIVFGALAFGWLAIELALKPWLVKARSAMD 40 >ref|XP_007050650.1| Outer envelope membrane protein 7 [Theobroma cacao] gi|508702911|gb|EOX94807.1| Outer envelope membrane protein 7 [Theobroma cacao] Length = 91 Score = 59.7 bits (143), Expect = 6e-07 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = +1 Query: 178 MAKQNSTKSAAIVFGALAFGWLAIEMALKPLLVKARSAMN 297 M K + K AA+VFGALAFGWLAIEMA KP+L KAR+AM+ Sbjct: 1 MGKSTAMKQAAVVFGALAFGWLAIEMAFKPILDKARAAMD 40 >gb|EPS72563.1| hypothetical protein M569_02199, partial [Genlisea aurea] Length = 62 Score = 58.5 bits (140), Expect = 1e-06 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = +1 Query: 178 MAKQNSTKSAAIVFGALAFGWLAIEMALKPLLVKARSAMN 297 M K N KSAAIV GALAFGWLAIE+ALKP L K RSA++ Sbjct: 1 MGKSNPVKSAAIVAGALAFGWLAIELALKPWLAKVRSAID 40 >ref|XP_002306767.1| outer envelope membrane family protein [Populus trichocarpa] gi|222856216|gb|EEE93763.1| outer envelope membrane family protein [Populus trichocarpa] Length = 77 Score = 56.2 bits (134), Expect = 7e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +1 Query: 199 KSAAIVFGALAFGWLAIEMALKPLLVKARSAMN 297 K AA+VFGALAFGWLAIEMA KP L KARSAM+ Sbjct: 7 KQAAVVFGALAFGWLAIEMAFKPFLDKARSAMD 39