BLASTX nr result
ID: Mentha29_contig00021440
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00021440 (466 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43287.1| hypothetical protein MIMGU_mgv1a022795mg [Mimulus... 59 7e-07 >gb|EYU43287.1| hypothetical protein MIMGU_mgv1a022795mg [Mimulus guttatus] Length = 350 Score = 58.9 bits (141), Expect = 7e-07 Identities = 32/79 (40%), Positives = 45/79 (56%), Gaps = 8/79 (10%) Frame = +3 Query: 24 MSEDFTDFYYRQPFQDDQRRXXXXXXXXXXXX------DLSTTFSADHSSADND--LRMF 179 MSE+ +FYY QP+ DDQRR S+T++ SS+ + L+MF Sbjct: 1 MSEELREFYYHQPYSDDQRRNTSGSGGGGGTTFPYSGGQYSSTYNTGDSSSVHAHYLQMF 60 Query: 180 DPSYLSFSQFMQGSDDHTS 236 DPSY+SF++F+ GS DH S Sbjct: 61 DPSYVSFAEFLHGSADHNS 79