BLASTX nr result
ID: Mentha29_contig00021116
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00021116 (206 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006432624.1| hypothetical protein CICLE_v10001225mg [Citr... 56 5e-06 ref|XP_006432621.1| hypothetical protein CICLE_v10003934mg, part... 56 6e-06 ref|XP_006432606.1| hypothetical protein CICLE_v10003679mg [Citr... 56 6e-06 >ref|XP_006432624.1| hypothetical protein CICLE_v10001225mg [Citrus clementina] gi|557534746|gb|ESR45864.1| hypothetical protein CICLE_v10001225mg [Citrus clementina] Length = 430 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/68 (42%), Positives = 39/68 (57%) Frame = +3 Query: 3 HNFLSRFGIGLHTLVKFAAKEESFIRGCYEGKVELSTKRLTEVILLDGIFIVELFLENHF 182 H FL R I V+ E+ +RG Y KVELS+ + E+ILLD FI+EL L HF Sbjct: 71 HCFLQRTNISFDEFVQIIKFREAELRGSYAEKVELSSDKFVEMILLDAAFIIELLLRYHF 130 Query: 183 LSLRDKNE 206 L+ K++ Sbjct: 131 RQLQKKDD 138 >ref|XP_006432621.1| hypothetical protein CICLE_v10003934mg, partial [Citrus clementina] gi|557534743|gb|ESR45861.1| hypothetical protein CICLE_v10003934mg, partial [Citrus clementina] Length = 376 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/68 (42%), Positives = 39/68 (57%) Frame = +3 Query: 3 HNFLSRFGIGLHTLVKFAAKEESFIRGCYEGKVELSTKRLTEVILLDGIFIVELFLENHF 182 H FL R I V+ E+ +RG Y KVELS+ + E+ILLD FI+EL L HF Sbjct: 57 HYFLQRTKISFDEFVQIIKFREAELRGSYAEKVELSSDKFVEMILLDAAFIIELLLRYHF 116 Query: 183 LSLRDKNE 206 L+ K++ Sbjct: 117 RQLQKKDD 124 >ref|XP_006432606.1| hypothetical protein CICLE_v10003679mg [Citrus clementina] gi|557534728|gb|ESR45846.1| hypothetical protein CICLE_v10003679mg [Citrus clementina] Length = 383 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/68 (42%), Positives = 39/68 (57%) Frame = +3 Query: 3 HNFLSRFGIGLHTLVKFAAKEESFIRGCYEGKVELSTKRLTEVILLDGIFIVELFLENHF 182 H FL R I V+ E+ +RG Y KVELS+ + E+ILLD FI+EL L HF Sbjct: 65 HYFLQRTQISFDEFVQIIKFREAELRGSYAEKVELSSDKFVEMILLDAAFIIELLLRYHF 124 Query: 183 LSLRDKNE 206 L+ K++ Sbjct: 125 RQLQKKDD 132