BLASTX nr result
ID: Mentha29_contig00020884
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00020884 (213 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25053.1| hypothetical protein MIMGU_mgv1a021752mg, partial... 96 4e-18 ref|XP_007040122.1| Integrase-type DNA-binding superfamily prote... 94 3e-17 ref|XP_002318847.2| AP2 domain-containing family protein [Populu... 93 3e-17 dbj|BAK09567.1| AP2/ERF domain-containing protein [Populus nigra] 92 6e-17 gb|EPS66754.1| hypothetical protein M569_08021 [Genlisea aurea] 92 7e-17 ref|XP_006421847.1| hypothetical protein CICLE_v10005869mg [Citr... 92 1e-16 ref|XP_002276184.1| PREDICTED: ethylene-responsive transcription... 91 2e-16 ref|XP_002510845.1| Dehydration-responsive element-binding prote... 91 2e-16 gb|ADE41109.1| AP2 domain class transcription factor [Malus dome... 90 3e-16 ref|XP_007210477.1| hypothetical protein PRUPE_ppa026499mg [Prun... 90 4e-16 ref|XP_006358864.1| PREDICTED: ethylene-responsive transcription... 89 5e-16 ref|XP_007038584.1| Integrase-type DNA-binding superfamily prote... 89 5e-16 ref|XP_006358390.1| PREDICTED: ethylene-responsive transcription... 88 1e-15 ref|XP_003570096.1| PREDICTED: ethylene-responsive transcription... 88 1e-15 ref|XP_006304750.1| hypothetical protein CARUB_v10012147mg [Caps... 88 1e-15 emb|CBI31845.3| unnamed protein product [Vitis vinifera] 88 1e-15 ref|XP_002446959.1| hypothetical protein SORBIDRAFT_06g025890 [S... 88 1e-15 ref|XP_002280043.1| PREDICTED: ethylene-responsive transcription... 88 1e-15 ref|NP_001147542.1| ap2/EREBP transcription factor [Zea mays] gi... 88 1e-15 ref|XP_006417215.1| hypothetical protein EUTSA_v10009659mg [Eutr... 87 2e-15 >gb|EYU25053.1| hypothetical protein MIMGU_mgv1a021752mg, partial [Mimulus guttatus] Length = 199 Score = 96.3 bits (238), Expect = 4e-18 Identities = 43/49 (87%), Positives = 47/49 (95%) Frame = +3 Query: 66 TSPTSGRHPVYRGIRCRSGKWVSEIRKPRETTRIWLGTYPTAEMAAAAY 212 +SPTSGRHPVYRGIR RSGKWVSEIR+PR+TTR+WLGTYPT EMAAAAY Sbjct: 16 SSPTSGRHPVYRGIRYRSGKWVSEIRQPRKTTRVWLGTYPTPEMAAAAY 64 >ref|XP_007040122.1| Integrase-type DNA-binding superfamily protein [Theobroma cacao] gi|508777367|gb|EOY24623.1| Integrase-type DNA-binding superfamily protein [Theobroma cacao] Length = 231 Score = 93.6 bits (231), Expect = 3e-17 Identities = 41/48 (85%), Positives = 46/48 (95%) Frame = +3 Query: 69 SPTSGRHPVYRGIRCRSGKWVSEIRKPRETTRIWLGTYPTAEMAAAAY 212 S +SG+HP+YRGIRCRSGKWVSEIR+PR+TTRIWLGTYPT EMAAAAY Sbjct: 66 SSSSGKHPMYRGIRCRSGKWVSEIREPRKTTRIWLGTYPTPEMAAAAY 113 >ref|XP_002318847.2| AP2 domain-containing family protein [Populus trichocarpa] gi|550327077|gb|EEE97067.2| AP2 domain-containing family protein [Populus trichocarpa] Length = 282 Score = 93.2 bits (230), Expect = 3e-17 Identities = 41/49 (83%), Positives = 45/49 (91%) Frame = +3 Query: 66 TSPTSGRHPVYRGIRCRSGKWVSEIRKPRETTRIWLGTYPTAEMAAAAY 212 T PTSGRHP Y+GIR RSGKWVSEIR+PR+TTR+WLGTYPT EMAAAAY Sbjct: 106 TQPTSGRHPSYKGIRLRSGKWVSEIREPRKTTRVWLGTYPTPEMAAAAY 154 >dbj|BAK09567.1| AP2/ERF domain-containing protein [Populus nigra] Length = 282 Score = 92.4 bits (228), Expect = 6e-17 Identities = 41/49 (83%), Positives = 45/49 (91%) Frame = +3 Query: 66 TSPTSGRHPVYRGIRCRSGKWVSEIRKPRETTRIWLGTYPTAEMAAAAY 212 T PTSGRHP Y+GIR RSGKWVSEIR+PR+TTR+WLGTYPT EMAAAAY Sbjct: 106 TLPTSGRHPSYKGIRLRSGKWVSEIREPRKTTRVWLGTYPTPEMAAAAY 154 >gb|EPS66754.1| hypothetical protein M569_08021 [Genlisea aurea] Length = 211 Score = 92.0 bits (227), Expect = 7e-17 Identities = 42/48 (87%), Positives = 45/48 (93%) Frame = +3 Query: 69 SPTSGRHPVYRGIRCRSGKWVSEIRKPRETTRIWLGTYPTAEMAAAAY 212 SP SGRHP+YRGIR RSGKWVSEIR+PR+TTRIWLGTY TAEMAAAAY Sbjct: 31 SPPSGRHPLYRGIRTRSGKWVSEIREPRKTTRIWLGTYTTAEMAAAAY 78 >ref|XP_006421847.1| hypothetical protein CICLE_v10005869mg [Citrus clementina] gi|568874437|ref|XP_006490322.1| PREDICTED: ethylene-responsive transcription factor ERF026-like [Citrus sinensis] gi|557523720|gb|ESR35087.1| hypothetical protein CICLE_v10005869mg [Citrus clementina] Length = 215 Score = 91.7 bits (226), Expect = 1e-16 Identities = 41/49 (83%), Positives = 45/49 (91%) Frame = +3 Query: 66 TSPTSGRHPVYRGIRCRSGKWVSEIRKPRETTRIWLGTYPTAEMAAAAY 212 +SP+ GRHP YRGIR RSGKWVSEIR+PR+TTRIWLGTYPT EMAAAAY Sbjct: 45 SSPSKGRHPSYRGIRSRSGKWVSEIREPRKTTRIWLGTYPTPEMAAAAY 93 >ref|XP_002276184.1| PREDICTED: ethylene-responsive transcription factor ERF024-like [Vitis vinifera] Length = 186 Score = 90.9 bits (224), Expect = 2e-16 Identities = 40/47 (85%), Positives = 45/47 (95%) Frame = +3 Query: 72 PTSGRHPVYRGIRCRSGKWVSEIRKPRETTRIWLGTYPTAEMAAAAY 212 P+ GRHP+YRGIR RSGKWVSEIR+PR+TTRIWLGT+PTAEMAAAAY Sbjct: 13 PSPGRHPMYRGIRSRSGKWVSEIREPRKTTRIWLGTFPTAEMAAAAY 59 >ref|XP_002510845.1| Dehydration-responsive element-binding protein 1B, putative [Ricinus communis] gi|223549960|gb|EEF51447.1| Dehydration-responsive element-binding protein 1B, putative [Ricinus communis] Length = 224 Score = 90.5 bits (223), Expect = 2e-16 Identities = 40/49 (81%), Positives = 45/49 (91%) Frame = +3 Query: 66 TSPTSGRHPVYRGIRCRSGKWVSEIRKPRETTRIWLGTYPTAEMAAAAY 212 +S +GRHP+YRGIRCRSGKWVSEIR+PR+TTRIWLGTY T EMAAAAY Sbjct: 46 SSGQTGRHPIYRGIRCRSGKWVSEIREPRKTTRIWLGTYTTPEMAAAAY 94 >gb|ADE41109.1| AP2 domain class transcription factor [Malus domestica] Length = 228 Score = 90.1 bits (222), Expect = 3e-16 Identities = 41/49 (83%), Positives = 44/49 (89%) Frame = +3 Query: 66 TSPTSGRHPVYRGIRCRSGKWVSEIRKPRETTRIWLGTYPTAEMAAAAY 212 TS +S RHP YRGIRCRSGKWVSEIR+PR+TTRIWLGTYP EMAAAAY Sbjct: 54 TSGSSRRHPFYRGIRCRSGKWVSEIREPRKTTRIWLGTYPKPEMAAAAY 102 >ref|XP_007210477.1| hypothetical protein PRUPE_ppa026499mg [Prunus persica] gi|462406212|gb|EMJ11676.1| hypothetical protein PRUPE_ppa026499mg [Prunus persica] Length = 184 Score = 89.7 bits (221), Expect = 4e-16 Identities = 39/48 (81%), Positives = 44/48 (91%) Frame = +3 Query: 69 SPTSGRHPVYRGIRCRSGKWVSEIRKPRETTRIWLGTYPTAEMAAAAY 212 S +SG+HP YRGIRCR GKWVSEIR+PR+T RIWLGT+PTAEMAAAAY Sbjct: 3 STSSGKHPTYRGIRCRGGKWVSEIREPRKTKRIWLGTFPTAEMAAAAY 50 >ref|XP_006358864.1| PREDICTED: ethylene-responsive transcription factor ERF025-like [Solanum tuberosum] Length = 188 Score = 89.4 bits (220), Expect = 5e-16 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = +3 Query: 72 PTSGRHPVYRGIRCRSGKWVSEIRKPRETTRIWLGTYPTAEMAAAAY 212 P G+H V+RGIRCRSGKWVSEIR+PR+TTRIWLGTYPT EMAAAAY Sbjct: 15 PIGGKHAVFRGIRCRSGKWVSEIREPRKTTRIWLGTYPTPEMAAAAY 61 >ref|XP_007038584.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma cacao] gi|508775829|gb|EOY23085.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma cacao] Length = 291 Score = 89.4 bits (220), Expect = 5e-16 Identities = 40/47 (85%), Positives = 42/47 (89%) Frame = +3 Query: 72 PTSGRHPVYRGIRCRSGKWVSEIRKPRETTRIWLGTYPTAEMAAAAY 212 P SGRHP YRGIR RSGKWVSEIR+PR+TTRIWLGTYPT EMAA AY Sbjct: 114 PGSGRHPTYRGIRSRSGKWVSEIREPRKTTRIWLGTYPTPEMAATAY 160 >ref|XP_006358390.1| PREDICTED: ethylene-responsive transcription factor ERF027-like [Solanum tuberosum] Length = 201 Score = 88.2 bits (217), Expect = 1e-15 Identities = 38/48 (79%), Positives = 44/48 (91%) Frame = +3 Query: 69 SPTSGRHPVYRGIRCRSGKWVSEIRKPRETTRIWLGTYPTAEMAAAAY 212 S T+ +HP+YRGIRCRSGKWV EIR+PR+TTRIWLGTYPT +MAAAAY Sbjct: 10 SRTNTKHPIYRGIRCRSGKWVCEIREPRKTTRIWLGTYPTPQMAAAAY 57 >ref|XP_003570096.1| PREDICTED: ethylene-responsive transcription factor ERF025-like [Brachypodium distachyon] Length = 217 Score = 88.2 bits (217), Expect = 1e-15 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = +3 Query: 75 TSGRHPVYRGIRCRSGKWVSEIRKPRETTRIWLGTYPTAEMAAAAY 212 ++GRHP YRGIRCR+GKWVSEIR+PR+ RIWLGTYPTAEMAAAAY Sbjct: 18 STGRHPFYRGIRCRNGKWVSEIREPRKARRIWLGTYPTAEMAAAAY 63 >ref|XP_006304750.1| hypothetical protein CARUB_v10012147mg [Capsella rubella] gi|482573461|gb|EOA37648.1| hypothetical protein CARUB_v10012147mg [Capsella rubella] Length = 216 Score = 87.8 bits (216), Expect = 1e-15 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = +3 Query: 84 RHPVYRGIRCRSGKWVSEIRKPRETTRIWLGTYPTAEMAAAAY 212 + PVYRGIRCRSGKWVSEIR+PR+TTRIWLGTYPTAEMAAAAY Sbjct: 32 KDPVYRGIRCRSGKWVSEIREPRKTTRIWLGTYPTAEMAAAAY 74 >emb|CBI31845.3| unnamed protein product [Vitis vinifera] Length = 273 Score = 87.8 bits (216), Expect = 1e-15 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = +3 Query: 75 TSGRHPVYRGIRCRSGKWVSEIRKPRETTRIWLGTYPTAEMAAAAY 212 T+GRHP YRGIRCR KWVSEIR+PR+TTRIWLGTYPT EMAA AY Sbjct: 86 TAGRHPFYRGIRCRGNKWVSEIREPRKTTRIWLGTYPTPEMAATAY 131 >ref|XP_002446959.1| hypothetical protein SORBIDRAFT_06g025890 [Sorghum bicolor] gi|241938142|gb|EES11287.1| hypothetical protein SORBIDRAFT_06g025890 [Sorghum bicolor] Length = 216 Score = 87.8 bits (216), Expect = 1e-15 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = +3 Query: 69 SPTSGRHPVYRGIRCRSGKWVSEIRKPRETTRIWLGTYPTAEMAAAAY 212 SP SG+HP YRGIR RSGKWVSEIR+PR+T RIWLGT+PTAEMAA AY Sbjct: 9 SPRSGKHPFYRGIRSRSGKWVSEIREPRKTRRIWLGTFPTAEMAAVAY 56 >ref|XP_002280043.1| PREDICTED: ethylene-responsive transcription factor ERF025-like [Vitis vinifera] Length = 237 Score = 87.8 bits (216), Expect = 1e-15 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = +3 Query: 75 TSGRHPVYRGIRCRSGKWVSEIRKPRETTRIWLGTYPTAEMAAAAY 212 T+GRHP YRGIRCR KWVSEIR+PR+TTRIWLGTYPT EMAA AY Sbjct: 66 TAGRHPFYRGIRCRGNKWVSEIREPRKTTRIWLGTYPTPEMAATAY 111 >ref|NP_001147542.1| ap2/EREBP transcription factor [Zea mays] gi|195612078|gb|ACG27869.1| ap2/EREBP transcription factor [Zea mays] gi|414585836|tpg|DAA36407.1| TPA: putative AP2/EREBP transcription factor superfamily protein [Zea mays] Length = 212 Score = 87.8 bits (216), Expect = 1e-15 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = +3 Query: 69 SPTSGRHPVYRGIRCRSGKWVSEIRKPRETTRIWLGTYPTAEMAAAAY 212 SP SG+HP YRGIR RSGKWVSEIR+PR+T RIWLGT+PTAEMAA AY Sbjct: 9 SPRSGKHPFYRGIRSRSGKWVSEIREPRKTRRIWLGTFPTAEMAAVAY 56 >ref|XP_006417215.1| hypothetical protein EUTSA_v10009659mg [Eutrema salsugineum] gi|557094986|gb|ESQ35568.1| hypothetical protein EUTSA_v10009659mg [Eutrema salsugineum] Length = 188 Score = 87.4 bits (215), Expect = 2e-15 Identities = 41/48 (85%), Positives = 45/48 (93%), Gaps = 2/48 (4%) Frame = +3 Query: 75 TSGRH--PVYRGIRCRSGKWVSEIRKPRETTRIWLGTYPTAEMAAAAY 212 T+GR PVYRGIRCRSGKWVSEIR+P++TTRIWLGTYPTAEMAAAAY Sbjct: 4 TAGRKKDPVYRGIRCRSGKWVSEIREPKKTTRIWLGTYPTAEMAAAAY 51