BLASTX nr result
ID: Mentha29_contig00020873
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00020873 (410 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21928.1| hypothetical protein MIMGU_mgv1a007997mg [Mimulus... 92 6e-17 >gb|EYU21928.1| hypothetical protein MIMGU_mgv1a007997mg [Mimulus guttatus] Length = 388 Score = 92.4 bits (228), Expect = 6e-17 Identities = 46/61 (75%), Positives = 48/61 (78%), Gaps = 1/61 (1%) Frame = -3 Query: 180 MEGSRVIADNADGAAENCSSGDGRPPIPSSLGGRGAYRNCLVSGGTPP-LSAKSLVRHSS 4 MEGSRVI DN D ENCSSGDGRPPIP+SLGGR YR+CL S G PP L KSLVRHSS Sbjct: 1 MEGSRVIIDNGDAGRENCSSGDGRPPIPNSLGGRTVYRHCLNSDGAPPSLCTKSLVRHSS 60 Query: 3 L 1 L Sbjct: 61 L 61