BLASTX nr result
ID: Mentha29_contig00020831
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00020831 (228 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007018168.1| Uncharacterized protein TCM_034473 [Theobrom... 59 9e-07 ref|XP_007141243.1| hypothetical protein PHAVU_008G179400g [Phas... 58 2e-06 >ref|XP_007018168.1| Uncharacterized protein TCM_034473 [Theobroma cacao] gi|508723496|gb|EOY15393.1| Uncharacterized protein TCM_034473 [Theobroma cacao] Length = 185 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/48 (58%), Positives = 35/48 (72%) Frame = -2 Query: 218 RKRVTGGGSSERNVKRNRSEEMAKGGMIIRPVFRNKVRRYKLLDEVSS 75 RKR+ E ++R +SEE++ G+I R VFRNKVRRYKLLDEVSS Sbjct: 138 RKRIITNARLEEKLRRTKSEEISNSGLITRHVFRNKVRRYKLLDEVSS 185 >ref|XP_007141243.1| hypothetical protein PHAVU_008G179400g [Phaseolus vulgaris] gi|561014376|gb|ESW13237.1| hypothetical protein PHAVU_008G179400g [Phaseolus vulgaris] Length = 198 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/50 (56%), Positives = 36/50 (72%) Frame = -2 Query: 224 SGRKRVTGGGSSERNVKRNRSEEMAKGGMIIRPVFRNKVRRYKLLDEVSS 75 S RKR+ G+ E ++R RSE++A G + VFRNKVRRYKLL+EVSS Sbjct: 149 STRKRIVTNGALEERLRRTRSEDIANSGGATKQVFRNKVRRYKLLEEVSS 198