BLASTX nr result
ID: Mentha29_contig00020123
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00020123 (370 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS62532.1| hypothetical protein M569_12259 [Genlisea aurea] 69 5e-10 ref|XP_006351292.1| PREDICTED: probable calcium-binding protein ... 68 2e-09 ref|XP_006398873.1| hypothetical protein EUTSA_v10013932mg [Eutr... 68 2e-09 ref|XP_004249218.1| PREDICTED: probable calcium-binding protein ... 68 2e-09 ref|XP_006664974.1| PREDICTED: probable calcium-binding protein ... 67 2e-09 ref|NP_001066106.1| Os12g0137100 [Oryza sativa Japonica Group] g... 67 2e-09 ref|NP_001065711.1| Os11g0140600 [Oryza sativa Japonica Group] g... 67 2e-09 emb|CBX24414.1| hypothetical_protein [Oryza glaberrima] 67 2e-09 emb|CBX25361.1| hypothetical_protein [Oryza brachyantha] 67 2e-09 ref|XP_002534120.1| ef-hand calcium binding protein, putative [R... 67 2e-09 gb|EEE52738.1| hypothetical protein OsJ_35159 [Oryza sativa Japo... 67 2e-09 gb|EEC67638.1| hypothetical protein OsI_35043 [Oryza sativa Indi... 67 2e-09 gb|EAZ17384.1| hypothetical protein OsJ_32908 [Oryza sativa Japo... 67 2e-09 ref|XP_004978627.1| PREDICTED: probable calcium-binding protein ... 66 4e-09 gb|AFW64764.1| grancalcin [Zea mays] 66 4e-09 gb|AFW64763.1| hypothetical protein ZEAMMB73_778929 [Zea mays] 66 4e-09 ref|XP_002450240.1| hypothetical protein SORBIDRAFT_05g002410 [S... 66 4e-09 gb|ACN31166.1| unknown [Zea mays] 66 4e-09 ref|NP_001147282.1| grancalcin [Zea mays] gi|195609464|gb|ACG265... 66 4e-09 ref|XP_004977495.1| PREDICTED: probable calcium-binding protein ... 65 7e-09 >gb|EPS62532.1| hypothetical protein M569_12259 [Genlisea aurea] Length = 278 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 368 GLTEKFKEKDTSFSGSATFTYETFMLTVLPFLIA 267 GLTEKFKE+DTSFSGSATFTYETFMLTVLPFLIA Sbjct: 245 GLTEKFKERDTSFSGSATFTYETFMLTVLPFLIA 278 >ref|XP_006351292.1| PREDICTED: probable calcium-binding protein CML49-like [Solanum tuberosum] Length = 344 Score = 67.8 bits (164), Expect = 2e-09 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -3 Query: 368 GLTEKFKEKDTSFSGSATFTYETFMLTVLPFLIA 267 GLTEKFKEKDTS+SGSATFTYE+FMLTVLPFLIA Sbjct: 311 GLTEKFKEKDTSYSGSATFTYESFMLTVLPFLIA 344 >ref|XP_006398873.1| hypothetical protein EUTSA_v10013932mg [Eutrema salsugineum] gi|557099963|gb|ESQ40326.1| hypothetical protein EUTSA_v10013932mg [Eutrema salsugineum] Length = 358 Score = 67.8 bits (164), Expect = 2e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 368 GLTEKFKEKDTSFSGSATFTYETFMLTVLPFLIA 267 GLTEKFKEKDT +SGSATFTYETFMLTVLPFLIA Sbjct: 325 GLTEKFKEKDTGYSGSATFTYETFMLTVLPFLIA 358 >ref|XP_004249218.1| PREDICTED: probable calcium-binding protein CML49-like [Solanum lycopersicum] Length = 340 Score = 67.8 bits (164), Expect = 2e-09 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -3 Query: 368 GLTEKFKEKDTSFSGSATFTYETFMLTVLPFLIA 267 GLTEKFKEKDTS+SGSATFTYE+FMLTVLPFLIA Sbjct: 307 GLTEKFKEKDTSYSGSATFTYESFMLTVLPFLIA 340 >ref|XP_006664974.1| PREDICTED: probable calcium-binding protein CML49-like [Oryza brachyantha] Length = 221 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 368 GLTEKFKEKDTSFSGSATFTYETFMLTVLPFLIA 267 GLTEKFKEKDT+FSGSATFTYE FMLTVLPFLIA Sbjct: 188 GLTEKFKEKDTAFSGSATFTYEAFMLTVLPFLIA 221 >ref|NP_001066106.1| Os12g0137100 [Oryza sativa Japonica Group] gi|77552964|gb|ABA95760.1| EF hand family protein, expressed [Oryza sativa Japonica Group] gi|113648613|dbj|BAF29125.1| Os12g0137100 [Oryza sativa Japonica Group] gi|125535715|gb|EAY82203.1| hypothetical protein OsI_37406 [Oryza sativa Indica Group] gi|215765243|dbj|BAG86940.1| unnamed protein product [Oryza sativa Japonica Group] Length = 292 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 368 GLTEKFKEKDTSFSGSATFTYETFMLTVLPFLIA 267 GLTEKFKEKDT+FSGSATFTYE FMLTVLPFLIA Sbjct: 259 GLTEKFKEKDTAFSGSATFTYEAFMLTVLPFLIA 292 >ref|NP_001065711.1| Os11g0140600 [Oryza sativa Japonica Group] gi|77548608|gb|ABA91405.1| EF hand family protein, expressed [Oryza sativa Japonica Group] gi|113644415|dbj|BAF27556.1| Os11g0140600 [Oryza sativa Japonica Group] gi|215737137|dbj|BAG96066.1| unnamed protein product [Oryza sativa Japonica Group] Length = 308 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 368 GLTEKFKEKDTSFSGSATFTYETFMLTVLPFLIA 267 GLTEKFKEKDT+FSGSATFTYE FMLTVLPFLIA Sbjct: 275 GLTEKFKEKDTAFSGSATFTYEAFMLTVLPFLIA 308 >emb|CBX24414.1| hypothetical_protein [Oryza glaberrima] Length = 286 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 368 GLTEKFKEKDTSFSGSATFTYETFMLTVLPFLIA 267 GLTEKFKEKDT+FSGSATFTYE FMLTVLPFLIA Sbjct: 253 GLTEKFKEKDTAFSGSATFTYEAFMLTVLPFLIA 286 >emb|CBX25361.1| hypothetical_protein [Oryza brachyantha] Length = 302 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 368 GLTEKFKEKDTSFSGSATFTYETFMLTVLPFLIA 267 GLTEKFKEKDT+FSGSATFTYE FMLTVLPFLIA Sbjct: 269 GLTEKFKEKDTAFSGSATFTYEAFMLTVLPFLIA 302 >ref|XP_002534120.1| ef-hand calcium binding protein, putative [Ricinus communis] gi|223525823|gb|EEF28264.1| ef-hand calcium binding protein, putative [Ricinus communis] Length = 266 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 368 GLTEKFKEKDTSFSGSATFTYETFMLTVLPFLIA 267 GLTEKFKEKDTS+SGSATFTYE FMLTVLPFLIA Sbjct: 233 GLTEKFKEKDTSYSGSATFTYEAFMLTVLPFLIA 266 >gb|EEE52738.1| hypothetical protein OsJ_35159 [Oryza sativa Japonica Group] Length = 263 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 368 GLTEKFKEKDTSFSGSATFTYETFMLTVLPFLIA 267 GLTEKFKEKDT+FSGSATFTYE FMLTVLPFLIA Sbjct: 230 GLTEKFKEKDTAFSGSATFTYEAFMLTVLPFLIA 263 >gb|EEC67638.1| hypothetical protein OsI_35043 [Oryza sativa Indica Group] Length = 153 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 368 GLTEKFKEKDTSFSGSATFTYETFMLTVLPFLIA 267 GLTEKFKEKDT+FSGSATFTYE FMLTVLPFLIA Sbjct: 120 GLTEKFKEKDTAFSGSATFTYEAFMLTVLPFLIA 153 >gb|EAZ17384.1| hypothetical protein OsJ_32908 [Oryza sativa Japonica Group] Length = 160 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 368 GLTEKFKEKDTSFSGSATFTYETFMLTVLPFLIA 267 GLTEKFKEKDT+FSGSATFTYE FMLTVLPFLIA Sbjct: 127 GLTEKFKEKDTAFSGSATFTYEAFMLTVLPFLIA 160 >ref|XP_004978627.1| PREDICTED: probable calcium-binding protein CML50-like [Setaria italica] Length = 307 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 368 GLTEKFKEKDTSFSGSATFTYETFMLTVLPFLIA 267 GLTEKFKEKDT++SGSATFTYE FMLTVLPFLIA Sbjct: 274 GLTEKFKEKDTAYSGSATFTYEAFMLTVLPFLIA 307 >gb|AFW64764.1| grancalcin [Zea mays] Length = 296 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 368 GLTEKFKEKDTSFSGSATFTYETFMLTVLPFLIA 267 GLTEKFKEKDT++SGSATFTYE FMLTVLPFLIA Sbjct: 263 GLTEKFKEKDTAYSGSATFTYEAFMLTVLPFLIA 296 >gb|AFW64763.1| hypothetical protein ZEAMMB73_778929 [Zea mays] Length = 84 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 368 GLTEKFKEKDTSFSGSATFTYETFMLTVLPFLIA 267 GLTEKFKEKDT++SGSATFTYE FMLTVLPFLIA Sbjct: 51 GLTEKFKEKDTAYSGSATFTYEAFMLTVLPFLIA 84 >ref|XP_002450240.1| hypothetical protein SORBIDRAFT_05g002410 [Sorghum bicolor] gi|241936083|gb|EES09228.1| hypothetical protein SORBIDRAFT_05g002410 [Sorghum bicolor] Length = 304 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 368 GLTEKFKEKDTSFSGSATFTYETFMLTVLPFLIA 267 GLTEKFKEKDT++SGSATFTYE FMLTVLPFLIA Sbjct: 271 GLTEKFKEKDTAYSGSATFTYEAFMLTVLPFLIA 304 >gb|ACN31166.1| unknown [Zea mays] Length = 153 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 368 GLTEKFKEKDTSFSGSATFTYETFMLTVLPFLIA 267 GLTEKFKEKDT++SGSATFTYE FMLTVLPFLIA Sbjct: 120 GLTEKFKEKDTAYSGSATFTYEAFMLTVLPFLIA 153 >ref|NP_001147282.1| grancalcin [Zea mays] gi|195609464|gb|ACG26562.1| grancalcin [Zea mays] Length = 301 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 368 GLTEKFKEKDTSFSGSATFTYETFMLTVLPFLIA 267 GLTEKFKEKDT++SGSATFTYE FMLTVLPFLIA Sbjct: 268 GLTEKFKEKDTAYSGSATFTYEAFMLTVLPFLIA 301 >ref|XP_004977495.1| PREDICTED: probable calcium-binding protein CML50-like [Setaria italica] Length = 291 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -3 Query: 368 GLTEKFKEKDTSFSGSATFTYETFMLTVLPFLIA 267 GLTEKFKEKD +FSGSATFTYE FMLTVLPFLIA Sbjct: 258 GLTEKFKEKDAAFSGSATFTYEAFMLTVLPFLIA 291