BLASTX nr result
ID: Mentha29_contig00020022
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00020022 (216 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533094.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 gb|EXC10675.1| hypothetical protein L484_025257 [Morus notabilis] 57 3e-06 ref|XP_002299869.1| hypothetical protein POPTR_0001s24810g [Popu... 57 3e-06 gb|EYU18985.1| hypothetical protein MIMGU_mgv1a011644mg [Mimulus... 55 8e-06 ref|XP_004241224.1| PREDICTED: PGR5-like protein 1B, chloroplast... 55 1e-05 >ref|XP_002533094.1| conserved hypothetical protein [Ricinus communis] gi|223527106|gb|EEF29286.1| conserved hypothetical protein [Ricinus communis] Length = 287 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/31 (77%), Positives = 30/31 (96%) Frame = +1 Query: 124 VFAFLRSDRSSHSPHRAECHVCESSLEFRTK 216 VFAF++SD+S++SPHRA+CHVCES LEFRTK Sbjct: 229 VFAFVKSDQSNNSPHRADCHVCESLLEFRTK 259 >gb|EXC10675.1| hypothetical protein L484_025257 [Morus notabilis] Length = 299 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +1 Query: 124 VFAFLRSDRSSHSPHRAECHVCESSLEFRTK 216 VFAF++SD+S+ SPHRA+CHVCES LEFRTK Sbjct: 239 VFAFVKSDQSNDSPHRADCHVCESLLEFRTK 269 >ref|XP_002299869.1| hypothetical protein POPTR_0001s24810g [Populus trichocarpa] gi|222847127|gb|EEE84674.1| hypothetical protein POPTR_0001s24810g [Populus trichocarpa] Length = 294 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +1 Query: 124 VFAFLRSDRSSHSPHRAECHVCESSLEFRTK 216 VFAF++SD+S+ SPHRA+CHVCES LEFRTK Sbjct: 236 VFAFVKSDQSNDSPHRADCHVCESLLEFRTK 266 >gb|EYU18985.1| hypothetical protein MIMGU_mgv1a011644mg [Mimulus guttatus] Length = 275 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 124 VFAFLRSDRSSHSPHRAECHVCESSLEFRTK 216 VFAF+RSDRS++S HR CHVCESSLEF+TK Sbjct: 215 VFAFVRSDRSTNSSHRVNCHVCESSLEFQTK 245 >ref|XP_004241224.1| PREDICTED: PGR5-like protein 1B, chloroplastic-like [Solanum lycopersicum] Length = 286 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/31 (70%), Positives = 29/31 (93%) Frame = +1 Query: 124 VFAFLRSDRSSHSPHRAECHVCESSLEFRTK 216 VFAFL++++S+HSPHRA+CHVC S LEF+TK Sbjct: 229 VFAFLKAEKSNHSPHRADCHVCGSRLEFQTK 259