BLASTX nr result
ID: Mentha29_contig00019336
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00019336 (881 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39485.1| hypothetical protein MIMGU_mgv1a0105402mg, partia... 49 1e-06 >gb|EYU39485.1| hypothetical protein MIMGU_mgv1a0105402mg, partial [Mimulus guttatus] Length = 153 Score = 49.3 bits (116), Expect(2) = 1e-06 Identities = 21/34 (61%), Positives = 25/34 (73%) Frame = -1 Query: 233 LHELHSCGYWLDNTLVWAQGCRDWQPISSVLGFS 132 L E +S GY L TLVW++GC DWQP+SSV G S Sbjct: 37 LQEHYSSGYLLPTTLVWSEGCTDWQPLSSVHGLS 70 Score = 30.4 bits (67), Expect(2) = 1e-06 Identities = 10/21 (47%), Positives = 18/21 (85%) Frame = -2 Query: 301 SSVRWYILGENRQPLGPYSIA 239 + V WYILG+++Q +GPY+++ Sbjct: 15 TGVGWYILGQDQQLVGPYTVS 35