BLASTX nr result
ID: Mentha29_contig00019027
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00019027 (347 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21445.1| hypothetical protein MIMGU_mgv1a014566mg [Mimulus... 55 1e-05 >gb|EYU21445.1| hypothetical protein MIMGU_mgv1a014566mg [Mimulus guttatus] Length = 185 Score = 55.1 bits (131), Expect = 1e-05 Identities = 33/68 (48%), Positives = 46/68 (67%), Gaps = 1/68 (1%) Frame = +1 Query: 145 NMEEGKGHHHMFQDSWFQYGDTLKNNNLDDEDER-CESSSATSSIGEDSDASNGSSITSS 321 +ME+GK + H+FQDSW L + D+ED++ SSS++SSIGE+S SN SSI+ Sbjct: 6 SMEQGK-NTHLFQDSW------LLHYQEDEEDQKPTSSSSSSSSIGEESTVSNQSSISCD 58 Query: 322 ELVDDASS 345 + DDASS Sbjct: 59 DTADDASS 66