BLASTX nr result
ID: Mentha29_contig00018934
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00018934 (458 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22875.1| hypothetical protein MIMGU_mgv1a021251mg [Mimulus... 58 1e-06 >gb|EYU22875.1| hypothetical protein MIMGU_mgv1a021251mg [Mimulus guttatus] Length = 379 Score = 58.2 bits (139), Expect = 1e-06 Identities = 31/68 (45%), Positives = 45/68 (66%) Frame = -3 Query: 435 LSPIKVFEDGGILLELGGNKLLYYSSKTKTIRRVDLSGLDHNIFSCTAIYAPSFLPLKTF 256 L PIKVF+DG L+ G + YYS KTKT +R+ + G+D ++ + ++ PSFL LK+F Sbjct: 310 LYPIKVFKDGHALMLFGNAYMCYYSGKTKTSKRMAVFGMDTHMEA--MVHTPSFLSLKSF 367 Query: 255 EMEDVSSF 232 E V+SF Sbjct: 368 PKEYVTSF 375