BLASTX nr result
ID: Mentha29_contig00018563
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00018563 (200 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB62671.1| Myb family transcription factor APL [Morus notabi... 56 6e-06 >gb|EXB62671.1| Myb family transcription factor APL [Morus notabilis] Length = 504 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/43 (67%), Positives = 31/43 (72%) Frame = +3 Query: 3 ATPKGVLKLMKVEGLTIYHVKSHLQVFILLL*WPSSEATFTVA 131 ATPKGVLKLMKVEGLTIYHVKSHLQ + L P + T A Sbjct: 291 ATPKGVLKLMKVEGLTIYHVKSHLQKYRLAKYMPEKKEVDTYA 333