BLASTX nr result
ID: Mentha29_contig00018524
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00018524 (441 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35903.1| hypothetical protein MIMGU_mgv1a004249mg [Mimulus... 62 1e-07 >gb|EYU35903.1| hypothetical protein MIMGU_mgv1a004249mg [Mimulus guttatus] Length = 537 Score = 61.6 bits (148), Expect = 1e-07 Identities = 35/65 (53%), Positives = 38/65 (58%), Gaps = 3/65 (4%) Frame = -3 Query: 439 SGAPPTGKPPMFKSSIGPRIPLPENQAGNMALSYQS---XXXXXXXXXXXXXXXXPGAGL 269 SGAPP GKPPMFKSSIGPRIPLPE A N+A S +S P GL Sbjct: 140 SGAPPPGKPPMFKSSIGPRIPLPETSASNVASSSKSEGEDATLMVPPLPPPPPPLPSTGL 199 Query: 268 DSGEG 254 DSG+G Sbjct: 200 DSGDG 204